KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_0013Help
Entry
SSUBM407_0013     CDS       T00935                                 

Definition
(RefSeq) PP-loop family protein
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssb03016]
    SSUBM407_0013
Enzymes [BR:ssb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     SSUBM407_0013
Transfer RNA biogenesis [BR:ssb03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SSUBM407_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C tRNA_Me_trans L51_S25_CI-B8 QueC
Motif
Other DBs
NCBI-GeneID: 8154022
NCBI-ProteinID: YP_003027800
UniProt: A0A0H3MSQ7
Position
11814..13082
Genome map
AA seq 422 aa AA seqDB search
MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQVLGIELGIAHINHGQRE
ESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFFATIMEKEGYTALVTAHHA
DDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKKADFEKLFHFEDCSNADF
KYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQALRDLTQDLSVTDVMSFQQQTP
AVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKANYYHLLKNDYMLEKDYHRFQIYKIG
PETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEADSILYFPTENPIVVRRRQAGDTILIN
GVNKKLRRWFIDNKISQKVRQNALIIEQNGEIYGITNLVSSDLSKSVKNDIIKATLYIKM
KE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagatttttaaaagtgacactggatggtcacttttttgataaacataagaaa
gtactagtagccgtatctggtgggttagattctatgaacctattccatcttttatacgaa
tgcaaacaagtgttagggattgaacttggaattgctcatattaatcatggacagagagaa
gaatctgtcattgaggaaaaatatcttagacagttagcagaagaaagtaatgttcccttt
tatctgtcctattttgaaggtgttttttcagaagaagcggcgcgaaaatggcgttatgga
ttttttgctacaatcatggagaaggaaggctacactgcactagtgacagcccaccatgca
gatgatcaagcagaaactgtctttatgcgattgattagaggcgggcgtttacgtcactta
tcagcaattcaaccgactcagccttttgcaacaggggaacttattcgaccacttttatct
tttaaaaaggcagattttgaaaagctatttcattttgaagattgcagcaatgcagatttc
aaatattttcgaaatagagtcagaaatgactatttaccaaagttaaaacaggaaaatcct
aaaatcgaacttactctcaataatcttgcagttgatacaaataatctatttcaagcgcta
agagatttgacacaggatttatccgttacagatgtgatgagttttcaacaacagacacct
gcggtacaaagttatctattagaggaatatttggaaaaatttcctgatttacagctctct
cgtccacaatttaatgaagtattacacatcttgcgttcaaaagctaactactatcattta
ttgaaaaatgattacatgctagaaaaggattatcatcgttttcaaatttataaaatagga
ccagagacggatagtcaaccagaaaaaatcatgatagaatcagaggggattttttcttac
ggttcatatattttttctctcaatcatcctttggaagaagcggatagtattttatatttt
cctacagaaaatccaattgtagtgaggagaaggcaggctggggataccattttaataaac
ggagtaaataaaaaactccgccgttggtttattgataataaaatctcacagaaagttcga
caaaatgcgcttattatcgagcagaatggagaaatttatggaattacgaatcttgttagc
agtgatttgagtaaatcagtaaaaaatgatataatcaaagctaccttatatataaaaatg
aaagagtag

DBGET integrated database retrieval system