KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_0490
Entry
SSUBM407_0490     CDS       T00935                                 

Definition
(RefSeq) hypothetical protein
Organism
ssb  Streptococcus suis BM407 (serotype 2)
SSDB
Motif
Pfam: TrbC Wzy_C
Other DBs
NCBI-GeneID: 8154833
NCBI-ProteinID: YP_003028253
UniProt: A0A0G2PMD5
Position
complement(549316..549537)
AA seq 73 aa
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVK
DILLELFNRIIGA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaattttggacaaaacctttataactggtttctatcaaacgctcaatcactggtgctt
ttagcaatcgttgtgattggcttgtatcttggcttcaagcgtgagtttagcaaactgatt
ggctttttaattattgcgattattgcggttggcttagtcttcaacgctgctggagtaaaa
gacattttactagagctattcaatcgcattattggtgcttaa

DBGET integrated database retrieval system