KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_0977Help
Entry
SSUBM407_0977     CDS       T00935                                 

Definition
(RefSeq) hypothetical protein
Organism
ssb  Streptococcus suis BM407 (serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 TBCC_N
Motif
Other DBs
NCBI-GeneID: 8154443
NCBI-ProteinID: YP_003028722
UniProt: A0A0G2PMD6
Position
1055189..1057636
Genome map
AA seq 815 aa AA seqDB search
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHA
LQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLL
NDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFK
IRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQR
YLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALS
TVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYKLSYVVRVSAN
DLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFA
NNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMK
NPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLS
TSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMEL
LSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVY
FVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQC
LISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcatatccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgt
tatgcttactatgagcttgttccttacaattactcatttctaagtccagaacagaaaata
caagtgcatgattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgct
ttacaaatcagtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtc
actggcaagctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaata
tccatgattggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctc
aacgatcaggagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgat
tttgtctatgatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaa
atcctgcgttttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaa
atccgcaggttagataaggacgacttcggctatctgattgaacacctttacggacagaca
ggcactgcctatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacg
ctgattaaatactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcga
tatttgaaaatccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagc
attgtcggagaactggacttcccgtcctctgaaatcttctactaccagcaacagcaattt
acattcccgattgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatct
actgtccgcaataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgat
aatgaaaccagctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaat
ttagaccaaagcaaggaatctatgtacaagctgtcttatgtggtaagggtatcagcaaat
gatcttgacgaactcaaacgtcgttgtaatgaagtgaaagatttttatgacgatttaagc
gtaaaactggtacgaccatttggggatatgctcggcttacatgaagaatttttacctgcc
agcaagcgttatatgaatgattatattcaatacgtgacctctgatttcctcgctggttta
ggttttggtgctactcaaatgctgggggaaaatgaggggatttatgttggctacagctta
gatactggacgcaatgtctatctgaaacctgctcttgccagtcaaggggttaagggttca
gtaaccaatgcgttagcgtcggcttttgttggttcgctgggtggtggtaaatcctttgcg
aataaccttatcgtctattatgcggtgctttatggggcacaagcagtgattgtagaccca
aaagcagaacgtggcagatggaaagaaaccttgccagagatttcccatgaaatcaatatc
gtcactctgacttctgatgagaaaaacaaaggcttacttgacccttatgtgattatgaaa
aatcccaaagattctgaatcactggctattgatattctgacattccttacggggatttcc
tctcgtgatggggaacgcttcccaatccttagaaaagccattcgtgcagtaaccaatagt
gaagtacgagggttgatgaaagtgattgaggaattacgggttgagaatacgccactaagt
accagtatagccgaccatatcgaaagttttacagactatgactttgcacatttattattc
agtaatggttatgtggagcagtctatcagcttagaaaaacaactgaacattatacaggtt
gcggacttggtacttcccgacaaggaaacttcctttgaggaatataccactatggagctt
ttatccgttgctatgctgattgtcattagtacctttgctttagactttatccatacagac
cgaagcattttcaagattgtagatttagacgaagcatggagctttttacaggtagcacaa
ggaaaaacactatctatgaagctggttcgggctggtcgtgctatgaacgctggggtatat
ttcgtgacccaaaatacagacgacctcttagatgaaaaactgaaaaataacctcggctta
aaatttgcatttcgttccactgaccttaacgagattaaaaagaccttagccttttttggt
gtagacccagaggacgaaaacaatcagaagcgattgcgtgatttggaaaacgggcaatgc
cttatcagtgatttatatggtcgtgtcggtgtgatacagttccaccctgtatttgaagaa
ctgctccatgcctttgataccagaccacctgtgcgaaaagaggtgtaa

DBGET integrated database retrieval system