KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1320Help
Entry
SSUBM407_1320     CDS       T00935                                 

Gene name
pfk
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Pathway
ssb00010  Glycolysis / Gluconeogenesis
ssb00030  Pentose phosphate pathway
ssb00051  Fructose and mannose metabolism
ssb00052  Galactose metabolism
ssb00680  Methane metabolism
ssb01100  Metabolic pathways
ssb01110  Biosynthesis of secondary metabolites
ssb01120  Microbial metabolism in diverse environments
ssb01130  Biosynthesis of antibiotics
ssb01200  Carbon metabolism
ssb01230  Biosynthesis of amino acids
ssb03018  RNA degradation
Module
ssb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_1320 (pfk)
   00030 Pentose phosphate pathway
    SSUBM407_1320 (pfk)
   00051 Fructose and mannose metabolism
    SSUBM407_1320 (pfk)
   00052 Galactose metabolism
    SSUBM407_1320 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SSUBM407_1320 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSUBM407_1320 (pfk)
Enzymes [BR:ssb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSUBM407_1320 (pfk)
Protein phosphatases and associated proteins [BR:ssb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSUBM407_1320 (pfk)
Messenger RNA biogenesis [BR:ssb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSUBM407_1320 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8153596
NCBI-ProteinID: YP_003029029
UniProt: A0A0H3MW25
Position
complement(1410033..1411043)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgatggttcttaccacggtgcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtacaattgataacgacatcgtgggtacagattttacaatcggttttgat
acagctgtaacaactgctatggatgcgattgataaaatccgcgatacttcatcaagtcac
cgtcgtactttcgttgttgaagtaatgggacgtcatgcgggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagcggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system