KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1527Help
Entry
SSUBM407_1527     CDS       T00935                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Pathway
ssb00010  Glycolysis / Gluconeogenesis
ssb00260  Glycine, serine and threonine metabolism
ssb00680  Methane metabolism
ssb01100  Metabolic pathways
ssb01110  Biosynthesis of secondary metabolites
ssb01120  Microbial metabolism in diverse environments
ssb01130  Biosynthesis of antibiotics
ssb01200  Carbon metabolism
ssb01230  Biosynthesis of amino acids
Module
ssb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_1527 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SSUBM407_1527 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUBM407_1527 (gpmA)
Enzymes [BR:ssb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSUBM407_1527 (gpmA)
Membrane trafficking [BR:ssb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSUBM407_1527 (gpmA)
Exosome [BR:ssb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSUBM407_1527 (gpmA)
  Exosomal proteins of melanoma cells
   SSUBM407_1527 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Imm70
Motif
Other DBs
NCBI-GeneID: 8154269
NCBI-ProteinID: YP_003029227
UniProt: A0A0H3N105
Position
complement(1603399..1604091)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTL
PPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccatggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcaatcgatgcaggt
aaattgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgt
gctatcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaa
aaatcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaa
gcagctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttg
ccaccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacac
cttgatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgccctt
ccattctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggt
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttg
aacattgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system