KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1528Help
Entry
SSUBM407_1528     CDS       T00935                                 

Gene name
atoB
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Pathway
ssb00071  Fatty acid degradation
ssb00072  Synthesis and degradation of ketone bodies
ssb00280  Valine, leucine and isoleucine degradation
ssb00362  Benzoate degradation
ssb00380  Tryptophan metabolism
ssb00620  Pyruvate metabolism
ssb00630  Glyoxylate and dicarboxylate metabolism
ssb00640  Propanoate metabolism
ssb00650  Butanoate metabolism
ssb00900  Terpenoid backbone biosynthesis
ssb01100  Metabolic pathways
ssb01110  Biosynthesis of secondary metabolites
ssb01120  Microbial metabolism in diverse environments
ssb01130  Biosynthesis of antibiotics
ssb01200  Carbon metabolism
ssb01212  Fatty acid metabolism
ssb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUBM407_1528 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSUBM407_1528 (atoB)
   00640 Propanoate metabolism
    SSUBM407_1528 (atoB)
   00650 Butanoate metabolism
    SSUBM407_1528 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSUBM407_1528 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSUBM407_1528 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUBM407_1528 (atoB)
   00310 Lysine degradation
    SSUBM407_1528 (atoB)
   00380 Tryptophan metabolism
    SSUBM407_1528 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUBM407_1528 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUBM407_1528 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSUBM407_1528 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssb04147]
    SSUBM407_1528 (atoB)
Enzymes [BR:ssb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUBM407_1528 (atoB)
Exosome [BR:ssb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUBM407_1528 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-GeneID: 8153211
NCBI-ProteinID: YP_003029228
UniProt: A0A0H3MWK7
Position
1604317..1605501
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system