KEGG   Sus scrofa (pig): 100037273Help
Entry
100037273         CDS       T01009                                 

Gene name
MEF2A
Definition
(RefSeq) myocyte-specific enhancer factor 2A isoform 2
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04022  cGMP-PKG signaling pathway
ssc04371  Apelin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100037273 (MEF2A)
   04022 cGMP-PKG signaling pathway
    100037273 (MEF2A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100037273 (MEF2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100037273 (MEF2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100037273 (MEF2A)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100037273 (MEF2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF HJURP_C GHD
Motif
Other DBs
NCBI-GeneID: 100037273
NCBI-ProteinID: NP_001093168
Ensembl: ENSSSCG00000028771
UniProt: A2ICN5
Position
1
AA seq 507 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESGTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLADSSML
SPPQATLHRNVSPGAPQRPPSTGSAGGMLSTSDLTVPNGAGSSPVGNGFVNSRASPNLVG
TTGANSLGKVMPTESPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR
ISSSQAPQPLATPVVSVTTPSLPQQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS
LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQ
QQQPPPPSQAPQPQPPQPQPQPQPQARQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP
VVLGRPPNTEDRESPSVKRMRMDAWVT
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaaagaagatacaaatcacacgcataatggatgaaaggaaccgacaggtcact
tttacaaagagaaagtttggactaatgaagaaagcctatgaacttagtgtgctctgtgac
tgtgaaatagcactcatcattttcaacagctctaacaaactgtttcagtatgccagcact
gatatggacaaagttcttctcaagtatacagaatataatgaacctcacgagagcggaacc
aactcggatattgttgaggctctgaacaagaaggaacacagagggtgcgacagcccagac
cctgatacttcctatgtgctaactccacatacagaagaaaaatataaaaaaattaatgag
gaatttgataatatgatgcggaatcataaaatcgcacccggtttgccacctcaaaacttc
tcaatgtctgtcacagtccctgtgaccagccctaatgctttgtcctacactaacccaggg
agttcacttgtgtccccgtctttggcagccagctcaacattagcagattcaagcatgctc
tctccacctcaagccacattacatagaaatgtatcccctggagcccctcagagaccacca
agtactggcagtgcaggtgggatgttgagcacttcagacctcacggtgccaaatggagct
ggaagcagcccagtggggaatggatttgtaaactcaagagcttctccaaatttggttgga
actactggtgcaaatagtttaggcaaagtcatgcctacagagtctcctcctcctccaggt
ggtggcaatcttggaatgaacagtaggaaaccagatcttcgcgttgtcatccccccttca
agcaagggcatgatgcctccactgtcggaggaagaggaattggagttgaatacccagagg
ataagcagttctcaagccccccagcccctagctaccccagtggtgtctgtgaccacccca
agtctgcctcagcaagggctggtgtactcagcaatgccaaccgcctacaacaccgattac
tcactgactagtgcagacctgtcagccctgcagggcttcaactccccaggaatgctgtct
ctgggacaggtgtcagcctggcagcagcaccatttaggacaagcagccctcagctctctt
gttgctggagggcagctatctcagggttcgaatttatccattaataccaaccaaaacatc
aacattaagtcagaaccaatttcacctccccgggatcgaatgaccccatcaggcttccag
cagcagcagccacctccgccatcacaggccccccagccacagccccctcagccccagcct
cagcctcagccccaggcccggcaggaaatgggccgctcccctgtggacagtctgagcagc
tccagcagctcctatgatggcagcgaccgggaggatccacggggtgacttccattctccg
gttgtgctcggccgacccccaaacactgaggacagagaaagcccttcagtaaagcgaatg
aggatggacgcatgggtgacctaa

DBGET integrated database retrieval system