KEGG   Sus scrofa (pig): 100037276Help
Entry
100037276         CDS       T01009                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 precursor
  KO
K06589  integrin beta 6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc04810  Regulation of actin cytoskeleton
ssc05165  Human papillomavirus infection
ssc05410  Hypertrophic cardiomyopathy (HCM)
ssc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100037276 (ITGB6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100037276 (ITGB6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100037276 (ITGB6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100037276 (ITGB6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100037276 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100037276 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    100037276 (ITGB6)
  Infectious diseases
   05165 Human papillomavirus infection
    100037276 (ITGB6)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100037276 (ITGB6)
Cell adhesion molecules [BR:ssc04515]
 Integrins
  Integrin beta subunits
   100037276 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 100037276
NCBI-ProteinID: NP_001090892
Ensembl: ENSSSCG00000015886
UniProt: Q1RPR6
Position
15
AA seq 788 aa AA seqDB search
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCSQENFTYLSGVGERCD
TPANLLAKGCQLNFIENPLSQVEILTNKPLSIGRQKNSSSIVQIAPQSLTLKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PISPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGVLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTPFPHQKKCSHMKVGDTASFNMT
VGIPNCEKRSRHVIVKPVGLGDALEILISPECSCDCQKEVEVNSSKCNHGNGSFQCGVCA
CNPGHMGPHCECGEDTLSMDSCREAPEHLSCSGRGDCYCGQCTCHLSPYGNIYGPYCQCD
DFSCVRHKGLLCGDNGDCECGECVCRSGWTGEYCNCTTSTDQCVSEDGVLCSGRGDCVCG
KCICTNPGASGLTCERCPTCGDPCNSKRSCIECHLSADGQAREDCVDKCKLAGATISEEE
DFSKDSAVSCSLQGENDCLITFLITTDNEGKTIIHSISEKDCPKPPNSPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSMDG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagagacctgtgaagactgcttactcattggaccgcag
tgtgcctggtgttctcaggagaattttacttatctctctggagttggagaaaggtgtgac
accccagcaaatcttttagctaaaggatgtcaactaaacttcatcgaaaaccctctctcc
caagtagaaatacttacaaataagcctctcagcataggcagacagaaaaatagttccagc
atcgttcagattgcacctcaaagcttgactcttaaattgagaccaggcagtgaacagact
ctgcaagttcaagttcgccagaccgaggactacccagtggacttgtattacctcatggac
ctctcggcctccatggatgacgacctcaacacgatcaaagagctgggctccctgctttcc
aaggagatgtctaaattaacgagcaactttagactgggctttggctcttttgtggaaaaa
cccatctccccatttatgaaaacaacgccagaagaaatcgccaacccttgcagtagtatt
ccatacttctgcttgcctacctttggattcaagcacattttgccgttgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgatactccggaa
ggtggatttgatgcaatcatgcaagccgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccatctcctggtctttgtgagtgatgccgattcacattttggaatggacagc
aaactggcgggcattgtcattcctaacgatgggctctgtcacttggacagcaagaatgaa
tactccatgtcaacagtcttggaatatccaaccattggacaactcattgataaactggta
caaaataacgtgttactgatctttgctgtaactcaagaacaagttcatctgtatgagaat
tatgcaaaactcattcctggagctacagtaggggtacttcagaaggactctgggaacatt
ctccagctgatcatctcggcttatgaagaactgcggtctgaggtggagctggaagtgtta
ggagacacggaaggactcaacctgtcatttacagccatctgtaacaatgggactcccttc
ccacaccaaaagaaatgctctcacatgaaggtgggagacacagcttcgttcaacatgact
gtggggataccaaactgtgagaaaagaagcaggcatgttattgtaaagcccgtggggctg
ggggacgccctagaaatcctgatcagtccagaatgcagctgcgactgtcagaaagaagtg
gaggtgaacagctccaaatgcaaccacggcaacggctccttccagtgtggggtgtgtgcc
tgcaaccctggccacatgggtcctcactgcgagtgcggggaggacacgctgagcatggac
tcctgcagggaggcccccgaacacctctcatgcagcgggagaggcgattgctactgtggg
cagtgcacctgccacttgtctccttatggaaacatttatgggccttactgccaatgcgat
gatttctcctgcgtgagacacaaggggctgctctgcggagataatggtgactgtgagtgc
ggcgagtgcgtgtgcaggagcggctggacaggcgagtactgtaactgcaccaccagcacg
gaccagtgcgtctcagaggatggggtgctctgcagcggtcgaggggactgtgtgtgcggc
aagtgcatttgcacgaaccctggagcctcaggactcacctgtgaacgctgtcccacctgt
ggcgatccctgtaactctaaacggagctgcattgaatgccacttgtctgctgatggccag
gcccgagaagactgtgttgacaaatgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatagtgctgtttcctgttctctgcaaggagaaaatgactgtcttatt
acattcctaataactacagataacgaagggaaaaccatcattcacagcatcagcgagaaa
gactgcccaaaacctcccaatagtcccatgatcatgttgggggtttcactggctattctt
ctcattggggttgtcctactgtgtatttggaagctgctggtgtcatttcacgatcggaaa
gaagttgccaaatttgaagcagaacggtcaaaggctaagtggcaaacgggaaccaatcca
ctgtacagaggctctaccagcacctttaaaaatgtaacctacaaacacagggaaaaacaa
aaggtggacctttccatggatggatag

DBGET integrated database retrieval system