KEGG   Sus scrofa (pig): 100037284Help
Entry
100037284         CDS       T01009                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 precursor
  KO
K06591  integrin beta 8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc04514  Cell adhesion molecules (CAMs)
ssc04810  Regulation of actin cytoskeleton
ssc05165  Human papillomavirus infection
ssc05410  Hypertrophic cardiomyopathy (HCM)
ssc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100037284 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100037284 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100037284 (ITGB8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100037284 (ITGB8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100037284 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100037284 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100037284 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100037284 (ITGB8)
  Infectious diseases
   05165 Human papillomavirus infection
    100037284 (ITGB8)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100037284 (ITGB8)
Cell adhesion molecules [BR:ssc04515]
 Integrins
  Integrin beta subunits
   100037284 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 100037284
NCBI-ProteinID: NP_001090893
UniProt: A4GUC2
Position
9
AA seq 767 aa AA seqDB search
MCRSALAFFTAAFVCLQNCRRGPASFLWAAWVFSVVLGLGQSEENRCTSSNAVSCTKCLA
LGPECGWCAQEDFISGGSRNERCDIVSNLINKGCSVNLIEYPSVHVIPSENEKNTQVTPG
EVLIQLREGAKANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNTVGNDLSRKMAFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYIRSTSVEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVKGIYFNITAICPDGTRKPGTDGCRN
VTSNDEVLFNVTVTMEKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDSRELKRKC
VEETFLDAKCSQCDENKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKLGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGKCQCFRGWEGDRCQCPSASTQHCVNPKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAILDQCKTSC
ALKEQHYADQMSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKSILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgctcggccctggctttttttaccgctgcatttgtctgcctgcaaaactgccgg
cgaggtcccgcctcgttcctctgggcagcctgggtgttttcagttgttcttggactgggc
caaagtgaagaaaacagatgtacgtcttcgaatgcagtgtcctgcaccaagtgccttgca
ctgggtccagaatgtggatggtgtgctcaagaggatttcatttcaggtggatcaaggaat
gaacgctgtgatattgtttccaatttaataaacaaaggctgctcagttaatttgatagaa
tacccatctgtgcatgtaataccaagtgaaaatgaaaagaatacccaggtgacaccggga
gaagtgctgatccaactgcgtgaaggtgctaaagccaattttatgctgaaaatccatcct
ctgaagaaatatcctgtggatctttattatctggttgatgtctcagcatcaatgcataat
aacattgaaaaattaaatacagttggaaatgatttatctagaaaaatggcatttttctcc
cgtgacttccgccttggatttggctcatatgttgataaaacagtttcaccatatattagt
atccatccagaaagaattcataatcaatgcagtgactacaacttggactgtatgcctccc
cacggctatattcatgtgctgtctttgacggagaatatcactgagtttgaaaaagcagtt
cacagacagaagatttctggaaatatagatacacctgaaggaggttttgatgctatgctt
caggcagctgtctgtgagagtcatattggatggcgaaaagaagctaaaagactgctgctg
gtgatgacagatcagacatctcatcttgctcttgacagcaaattggctggcatagtggtg
ccaaatgacggaaactgccatctgaaaaacaacgtctacatcagatcaacaagcgtggaa
catccctccctaggccaactttcagaaaaattaatagacaacaacattaatgtcatcttt
gctgttcaaggaaaacagtttcattggtataaggatcttctacccctcctgcctggcacc
attgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtagaagcctat
cagaaactaatttcagaagtgaaagttcaggtggaaaaccaggtaaaaggcatctatttt
aatattactgccatctgtccagatgggaccaggaagccaggcacagacggatgcagaaat
gtgacaagcaatgacgaagttcttttcaatgtaacagttacaatggaaaaatgtgatgtc
acgggaggaaaaagctatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
catatacacagaaactgcagctgtcaatgtgatgacagcagagaacttaaaagaaagtgt
gtagaagaaacttttctggatgccaagtgttcccagtgtgatgagaataaatgtcatttt
gatgaagatcaatttccttctgaaagttgcaagtcacacaaggatcaacctgtttgcagt
ggtagaggagtttgtatttgtgggaaatgtttatgtcacaaaattaagcttggaaaagtg
tatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaaatctgtgt
gctgggcatggagagtgtgaagcaggcaaatgccagtgcttcaggggctgggaaggggat
cggtgccagtgcccatcagcatcgacccagcactgcgtcaatccaaagggccaagtgtgt
agtggaagaggcacatgtgtatgtggcaggtgtgaatgcaccgatcccagaagcattggc
cgtttctgtgaacattgtcccacatgtcacacagcctgcaatgaaaactggaattgtgtg
caatgccttcaccctcacaatctgtctcaagctatacttgatcagtgtaaaacctcatgt
gctctcaaggaacagcattatgcggaccaaatgtcagaatgtttctctagcccgagctat
ttgagaatatttttcatcatcttcatagttacattcttgattgggttgcttaaagtcctt
atcattagacaggttatactacaatggaatagtaataaaattaagtcctcggcagattac
agggtatcagcctcaaaaaaggacaagtcaattctacaaagtgtttgcacaagagcggtc
acctaccgacgtgagaaacctgaagaaataaaaatggatattagcaaattaaatgctcat
gaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system