KEGG   Sus scrofa (pig): 100037289
Entry
100037289         CDS       T01009                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100037289 (IRF7)
   04621 NOD-like receptor signaling pathway
    100037289 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100037289 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100037289 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100037289 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100037289 (IRF7)
   05160 Hepatitis C
    100037289 (IRF7)
   05164 Influenza A
    100037289 (IRF7)
   05162 Measles
    100037289 (IRF7)
   05168 Herpes simplex virus 1 infection
    100037289 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100037289 (IRF7)
   05169 Epstein-Barr virus infection
    100037289 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100037289 (IRF7)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100037289 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF Tecti-min-caps
Other DBs
NCBI-GeneID: 100037289
NCBI-ProteinID: NP_001090897
Ensembl: ENSSSCG00000012853
Vega: OTTSUSG00000002856
UniProt: A0ZVR0 A0A4X1VZ72
Position
2
AA seq 487 aa
MAAAPDRGCPRVLFGDWLLGEVSSGRYAGLRWLDEARTRFRVPWKHFARKDLGESDSRIF
KAWAVARGRWPPRSSEGAQPIPEGALRASWKTNFRCALHSTRRFVMLQDNSGDPTDPHKV
YMINPELGCGEGPGFNPGEEEALEDAPPPRGELPGPRLAAHTGERLRHELARPSPEPCTP
SPAGDGGDLLLQALQQSCMEDHLLEAAWGVDLTPPEVPYAGPLPAPVPWKPQEAEPCTTL
YPRVCTRMAGERGAASPSCSQLGLHAGPSLEALDLTIMYKGRTVLQEMVGGPSCVLLYGS
PGPAGAAAEPQQVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLEFRGPKLWARRLGKCKV
YWEVGGPLGSGSPSTPACLLPRDCDTPIFDFGTFFQELMEFRARRRQGSPHYTIYLGFGQ
DLSVGRPKEKSLVLVKLEPWLCRTQLESVQREGVSSLDSGSLSLCLSPSNSLYDELERFL
MEVEQPA
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggccgcggctcctgacagggggtgcccacgcgtgctcttcggagactggcttctgggc
gaagtcagcagcggccgttacgcagggctgcgatggctggatgaagccagaacacggttc
cgcgtgccctggaagcacttcgcccgaaaggacctgggcgagtccgactcgcgcatcttt
aaggcctgggccgtggcccgcggcaggtggccgccccgcagcagcgaaggtgcgcagccg
atcccggagggtgccctccgcgcctcctggaaaaccaacttccgctgtgccctgcacagc
acgcggcgcttcgtgatgttgcaggacaactcaggggaccccactgaccctcataaggtg
tatatgatcaaccccgagctggggtgcggagaaggcccaggcttcaacccgggggaagag
gaggccctcgaggatgccccacccccaaggggtgagcttcccgggccgcgcctggcagca
catactggtgagaggctgaggcacgagctggccaggccgagccctgaaccctgcacccca
agcccagctggagatggtggggacctcctgctccaggctctgcagcagagctgcatggag
gaccatctgctggaagctgcatggggcgtggatctgaccccccccgaggttccatatgca
ggcccactcccagccccggtgccctggaagccccaagaggcggagccctgcaccacactc
tacccccgtgtctgcacgcggatggcaggcgagcggggcgcggccagtcccagctgctca
cagctcggtctgcacgcagggcccagcttggaggccctggacttgaccatcatgtacaaa
ggtcgaacggtgctgcaggagatggtggggggccccagctgtgtgctcctgtacgggtct
ccgggcccggctggcgcggctgcagagccccagcaggtagccttccccagccccgctgag
ctgcctgaccagaagcagctccactacacagagaagctgctgcagcacgtggcccccggc
ctgcagctggagttccggggacccaagctgtgggcccggcgcctgggcaagtgcaaagtc
tactgggaggtgggagggcccctgggctctggcagcccctccacccccgcctgcctgctg
ccccgagactgcgacacccccatcttcgacttcggcaccttcttccaagagttgatggag
ttccgggcccgccggcgccagggctccccacactacaccatctacctgggcttcgggcag
gacctctccgtggggaggcccaaggagaagagcctcgtcctggtgaagttggagccatgg
ctgtgtcggacacagctggagagcgtgcagcgtgaaggcgtgtcctccctggacagcggc
agcctcagcctctgcctgtccccctccaacagcctctatgacgagctggagcgcttcctg
atggaggtggagcagccggcctag

DBGET integrated database retrieval system