KEGG   Sus scrofa (pig): 100037290
Entry
100037290         CDS       T01009                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05164  Influenza A
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100037290 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    100037290 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    100037290 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100037290 (MAVS)
   05160 Hepatitis C
    100037290 (MAVS)
   05171 Coronavirus disease - COVID-19
    100037290 (MAVS)
   05164 Influenza A
    100037290 (MAVS)
   05162 Measles
    100037290 (MAVS)
   05168 Herpes simplex virus 1 infection
    100037290 (MAVS)
   05169 Epstein-Barr virus infection
    100037290 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 100037290
NCBI-ProteinID: NP_001090898
Ensembl: ENSSSCG00000007143
UniProt: A0ZVR1
Position
17
AA seq 524 aa
MTFAEDKTYQYIRNHHRNFCKIHVLEILPYLSCLTASDQDRLRASFERWGNQGTLWDLFD
SLRRRSGWVQSFIGALRICELSDLADEVSRVYQNSLLRNSNSPPAPLEPPSTPAEAPGPS
RPAVAPSIPHNGYREDEPSYPMPVQDTQSPEAPGESSKTAPQPPNSGAVLKRPGGPLEPS
SDVALSPLTSGGHQKQDTELGSAHTAGTVSSPTSPRGPVSPTVSFQPLARSTPRASRLPG
PPVSTASSSTGLASAGGAGDQVEATICSGGAGVPTTSVTASMVPSKVPTNSAFASTMPSK
LPTSLKPPGAMSTNVSPSVAPSKLPINSTRPGAMSPKVPTGLLPDHRKPTSTVASKVPAN
TGPTIRSSNRPEKETPASPAPIGTAAGGTSPWPDSNSDRWDSEEPELSKPGRLVSRMDSQ
PFSGSSEDLAISYSNPLGSGPDNTPEENEYVSVDTIRIQGDPSTPPVGDSPGPLTASEFQ
AEEELEEGLEEVKTEARAPWVGVAVVGVLLATLLAMLYRRRLPQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgacgtttgccgaggacaagacttatcagtatatccgcaaccatcacaggaatttttgc
aagatccatgttctggagattctgccttacctgtcctgcctcacagcaagtgaccaggac
cgactgcgggcctcctttgagcgctggggcaaccagggcaccctctgggacctcttcgac
agccttcggcggaggagcggctgggtacagtccttcatcggggcactgaggatctgtgag
ctgtctgatctcgctgacgaagtgtcccgtgtctaccagaacagcctgctgcggaattca
aacagccccccagctccactggagccgccatctactcctgctgaggctccagggccttcc
agacctgctgtggcccccagcatcccccacaatggctacagagaggatgagccaagttac
cccatgcctgtccaggatacccagtcgccagaggccccaggagagagttcaaagacagcg
ccacagccacccaactctggggctgtcctgaagaggccaggtggccccctggagccctcc
tctgatgtggccctcagccctctgacctcaggtgggcatcagaagcaggacacagaactg
ggcagtgcccacacagcaggcacggtctccagccccacgtcaccccgtgggcctgtgtct
ccgactgtctccttccagcccttggcccgttctacccccagggcaagccgtttgcctgga
ccacccgtgtctactgcctcctcctccactggcttggcctctgcaggtggagctggtgac
caggttgaagctaccatctgctccggtggggcaggggtgcccaccacctctgtgactgcc
agcatggtgccctctaaagtgcccaccaactcagcatttgccagcaccatgccttccaag
ttgcccaccagcctcaagccccctggtgcaatgtccactaacgtgtcccccagtgtagca
ccatccaaattgcccatcaactccacgcgtcctggcgcaatgtcacccaaagtgcctact
ggcttgctgccggaccacaggaaacctacaagcacggtggccagcaaggtgcctgccaac
actgggcccaccatcaggagcagcaaccgtcctgaaaaggagactccagcatctccagcg
cccataggcactgctgctggaggcacctcgccctggccagacagcaactctgaccgctgg
gactcagaggagccggagctgagcaagcctggtaggctggtgtccaggatggatagccag
cctttctcgggctcctccgaggacctcgccatcagctacagcaatcctctgggctcaggg
cctgacaacaccccagaggagaacgagtacgtgtcagtggatactattaggatccagggg
gaccccagcaccccacctgtaggggacagcccggggccactcactgcctcggagttccag
gcagaggaggagttggaagaggggttggaagaggtcaagactgaggctagggctccgtgg
gttggggtggcggtggttggggtgcttctggccacactcctggccatgctgtaccggcgg
cgcctgccccagtga

DBGET integrated database retrieval system