KEGG   Sus scrofa (pig): 100037992
Entry
100037992         CDS       T01009                                 

Symbol
PSMB7
Name
(RefSeq) proteasome subunit beta type-7 precursor
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03050  Proteasome
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100037992 (PSMB7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100037992 (PSMB7)
   05012 Parkinson disease
    100037992 (PSMB7)
   05014 Amyotrophic lateral sclerosis
    100037992 (PSMB7)
   05016 Huntington disease
    100037992 (PSMB7)
   05017 Spinocerebellar ataxia
    100037992 (PSMB7)
   05020 Prion disease
    100037992 (PSMB7)
   05022 Pathways of neurodegeneration - multiple diseases
    100037992 (PSMB7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100037992 (PSMB7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ssc03051]
    100037992 (PSMB7)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100037992 (PSMB7)
Peptidases and inhibitors [BR:ssc01002]
 Threonine peptidases
  Family T1: proteasome family
   100037992 (PSMB7)
Proteasome [BR:ssc03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    100037992 (PSMB7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 100037992
NCBI-ProteinID: NP_001090945
Ensembl: ENSSSCG00000005590
UniProt: A1XQU1
Position
1
AA seq 277 aa
MAAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPEMEEEEAKQLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFFRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTALDIEVLEETVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcagtgtatgagcgacccgttggaggtttctcttttgataactgccgc
cgaaatgctatcttggaagccgactttgcaaagaaaggatacaagcttccaacggctcgt
aaaactgggacgaccatcgccggggtggtctataaggacggcatagttcttggagcagat
acaagggcaactgaagggatggttgttgctgacaagaactgctcaaaaatacacttcata
tctcctaacatttattgttgtggtgctgggacagctgcggacacagacatgacaacccaa
ctcatttcctccaacttggagctccactcgctctccactggccgccttcctagggttgtg
acagccaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtagatgttactggacctcacctctacagcatctatcctcacgga
tcaactgataagttgccttatgtcaccatgggttctggctctttggcagcaatggccgtg
tttgaagataaatttaggccagagatggaggaggaggaagccaagcagctagtgagtgaa
gccatagccgccggcatcttcaatgacctggggtctggaagtaacattgatctctgtgtc
atcagcaagagcaagctggattttttccgcccgtactccgtgcccaacaagaaggggacc
aggtttggccggtacaggtgtgagaaagggaccactgcagtcctcaccgaaaaggtcact
gccctggacattgaggtcctggaagaaacagtccagacaatggacacgtcctga

DBGET integrated database retrieval system