KEGG   Sus scrofa (pig): 100038030
Entry
100038030         CDS       T01009                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X2
  KO
K03259  translation initiation factor 4E
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc03013  RNA transport
ssc04066  HIF-1 signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04211  Longevity regulating pathway
ssc04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100038030 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100038030 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100038030 (EIF4E)
   04150 mTOR signaling pathway
    100038030 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100038030 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    100038030 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100038030 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100038030 (EIF4E)
   03012 Translation factors [BR:ssc03012]
    100038030 (EIF4E)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100038030 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100038030 (EIF4E)
Translation factors [BR:ssc03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    100038030 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 100038030
NCBI-ProteinID: XP_003129362
Ensembl: ENSSSCG00000028420
UniProt: A0A4X1UC72 A0A5G2RC36
Position
8
AA seq 217 aa
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacaa
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctctacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacgttgaacaaacag
cagagacgaagtgacctcgatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaagggt
gataaaatagcaatatggactactgaatgtgaaaacagagatgctgttacacatataggg
agggtatacaaagaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system