KEGG   Sus scrofa (pig): 100048958Help
Entry
100048958         CDS       T01009                                 

Gene name
GNA14
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-14
  KO
K04636  guanine nucleotide-binding protein subunit alpha-14
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc05142  Chagas disease (American trypanosomiasis)
ssc05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100048958 (GNA14)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100048958 (GNA14)
   05142 Chagas disease (American trypanosomiasis)
    100048958 (GNA14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100048958 (GNA14)
GTP-binding proteins [BR:ssc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100048958 (GNA14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Atx10homo_assoc AAA_24 GUN4
Motif
Other DBs
NCBI-GeneID: 100048958
NCBI-ProteinID: NP_001090987
Ensembl: ENSSSCG00000005284
UniProt: A4L2Z4 A0A4X1VWA1
Position
1
AA seq 355 aa AA seqDB search
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQLIREVEVDKVSAL
SRDQVEAIKELWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgctgctgcctgtccgcggaggagaaggagtcccagcgcatcagcgccgag
atcgagcggcagcttcgccgggacaagaaggacgcgcgccgcgagctaaagctgctgttg
ttgggaaccggtgaaagtggcaaaagcacctttatcaagcaaatgagaattatccatggg
tctggttacagtgacgaagacagaaaggggttcacgaagctggtttatcaaaacatattc
actgccatgcaagccatgatcagagccatggacaccctgaggatacagtacgtgtgtgag
cagaataaggagaatgcccagctaatcagagaagtggaagtagacaaggtctccgcactc
tccagggaccaggtggaggccatcaaggagctctggcaggacccgggaatccaggagtgt
tatgacaggaggagggaataccagctgtcagactctgctaagtattacctgactgacatt
gaccggattgccatgccatcgtttgtgccaacacagcaagatgtgcttcgtgtccgtgtg
cccacaactggcatcattgaatatccatttgacttggaaaacataatctttcggatggtg
gatgttggtggccagcgatctgaaagacggaaatggattcattgctttgagagtgtcact
tccataatttttttggttgctctgagtgaatatgaccaggtcctggctgagtgtgataat
gagaaccgcatggaagagagcaaagccttatttaaaaccatcatcacatacccctggttt
ctgaactcatcggtgattttgttcttaaataagaaggatcttttggaagagaaaatcatg
tactcccatctaattagctattttccagagtacactggaccaaagcaagatgtcaaagct
gccagagattttatcctgaaactttatcaagatcagaatcctgacaaagagaaagtcatc
tattcccacttcacatgtgctacagacacagagaatatccgcttcgtgtttgctgctgtg
aaagacacaattctacaactaaacctgagggaattcaacctggtttag

DBGET integrated database retrieval system