KEGG   Sus scrofa (pig): 100101922
Entry
100101922         CDS       T01009                                 
Symbol
ATM
Name
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc03440  Homologous recombination
ssc04064  NF-kappa B signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05202  Transcriptional misregulation in cancer
ssc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100101922 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100101922 (ATM)
   04068 FoxO signaling pathway
    100101922 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100101922 (ATM)
   04210 Apoptosis
    100101922 (ATM)
   04115 p53 signaling pathway
    100101922 (ATM)
   04218 Cellular senescence
    100101922 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100101922 (ATM)
   05206 MicroRNAs in cancer
    100101922 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100101922 (ATM)
   05170 Human immunodeficiency virus 1 infection
    100101922 (ATM)
   05165 Human papillomavirus infection
    100101922 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100101922 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100101922 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100101922 (ATM)
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100101922 (ATM)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100101922 (ATM)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100101922 (ATM)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    100101922 (ATM)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100101922 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 100101922
NCBI-ProteinID: NP_001116552
UniProt: Q6PQD5
Position
9:36620656..36759555
AA seq 3057 aa
MSLALNDLLICCRQLEHDRATERRKAVENFRHLIQDPETVQHLDQHSDSKQGKYLNWDAA
FRFLQKYIQKETECLRTAKQNVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVRDSSNNPIYGADYSNILLKDILSVRKYWCEISQQQWRELFLIYFTLYLKPSQ
DINRLLVARIIQAVTKGCCSQTDGLNSEFLDFFTKAIQNARQEKSSPGLNHILAAYVIFL
KTLAANFRIRVCELGDKILPTLLYIWTQHRLNDSLKEVIVELFQLQVYMHHPKGAKTQEK
GAYESAKWKSILYNLYDLLVNEISRIGSRGKYSSGSRNIAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQREFSDYNAPCKKRKIELGWGVIKDHLQKSQNDFDVVPWLQIATQLI
SKYPASLPNCELSPLLMILYQLLPQQRRGERTPYVLRCLMEVALCQGKKPNLESSHKSDL
LKIWIKIWSITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWKLFTGSACKPSCPTVC
CLTLALKTCVVPETVETGMENICDGNRKFSLKESIMKWLLFCQLEDDFEDRIELPPILHS
NFPHLALEKILVSLIMKNCKAAMNFFQSVPECEQHQKDTEEPSLLEVEELFLQTTFDKMD
FLTVVQECTIEKHQSSVGFSFHQNLKESLDRYLLGLSEQLLNNYLPETSDSETLVRCSSL
LVGVLGCYCYVGVIAEEEAYTSELFQKAKSLMQCAGESITLFKSKTNEESRIISLRNMMH
LCTNCLYKCAKRSPNKIASGFFLRLLTSKLMHDIADVCRSLAFIIKKPFDCREVESMEDD
TDKNLMEMNDQSSMSLFNDNPASSVIDANESGESQITMGAMNPLAEEHLSKQDLLVLDML
RFLCMCITIAQSNTMSFRAADIRRKLLMLIDSDRLDPTKSLHLHMYLVLLKELPGEEYPL
PMEDVVELLKPLSSVCSLYRRDQDVCKTILNHVLHIVPNLCRENVDAESTRDAQGQFLTV
IGAFWHLTKEGKCTFSVRLALVKCLKTLLEADPYSRWAILNVMEKDFPVNEVFPQFLADN
HHQVCMLAAGLINRLFQHMKQGDSSTIMRALPLKLQQTAFENAYLKAQERIRQVKSQGGE
NRELLDEICNRKAVLLTMIAVVLCCSPVCEKQALFALCKSVKENGLEPHLIKKVLEKVSE
TFGYRHLEDFMASHLDYLVLEWLHLQDAEYSLSSFPFILLNYTNIEDFYRSCYKVLIPHL
VMRCHFDEVKSIANQIQGDWKSLLTDCFPKILVNILPYFAYEDTGDRGMAQQRETASKVY
DMLKDENLLGKQIDQLFINNLPEIVVELLMTLHEPATSDASQSTDPCDFSGDLDPRPNPP
HFPSHVIKATFAYISNCHKTKLKSILEVLSKSPDSYQKILLAICEQAAETNNVYKKHRIL
KIYHLFVSLLLKDMKSGLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLS
RVCHTAVTYSKDALESHLHVIVGTLIPLVDGQMEVQKQVLDLLKYLVIDNKDNENLYVMI
KLLDPFPDNAVFKDLRITQQEIKYSKGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRR
QLAQHKDQMMDLMRASQDNPQDGIVVKLVVSLLQLSKMAVNHTGEREVLEAVGRCLGEVG
PIDFSTIAIQHSKDMPYTKALELFEDKEHHWTLMMLTYLNSTLVEDCVKVRSAAVTCLKS
ILATKTGHGFWEIFKTTADPMLTYLLPFRTSRKKFLEVPRLNKESPLEGLDDISLWIPQS
ENHDIWIKTLTCALLDSGGINSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWR
SLLSTHIQGFFTNCFRHSSQTSRSTTPANMDSESEHVFRCHLDKKSQRTMLAVVDYMRRQ
KRSSSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNMDDQEKRSPTFEE
GSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHE
AMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDHENKEQCAELQELH
YQVAWRNMQWDSCVSVNKGMEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEELC
KGSLESVYSLYPTLSRLQAIGELENIGELFSRSVTDRQPSEVYNKWWKHSQLLKDSDFSF
QEPIMALRTVILEILMEKEMENSQRECLKDILTKHLVELSLLARTFQNTQLPERAIFQIK
QYNSANCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENDPRLKLIHIECLR
VCGTWLAETCLENPAVIMQTYLEKAVELAGNYDGESNDELRNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTIKVQRELELDEGALRALKKDR
KRFLCKAVENYINCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLPL
MYQLAARMGTKMMGGLGFHDVLNSLISRISVDHPHHTLFIILALANANKDEFLTKPEAAR
SSRITKNTPKESSQLDEDRTEAANKVICTLRNRRRQMVRSVEALCDAYIILANLDATQWR
TQRKGIRIPADQPITKLKNLEDVVVPTMEIKVDPTGEYGNMVTIQSFKPEFRLAGGLNLP
KIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEYLVNNDTGAHKRYRPKDFSPVQCQKKMMEAQNKSFEEKYEI
FMNICQNFQPVFRYFCMEKFLDPAVWFERRLAYTQSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
NSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESELHSTPRADDQECKRNLSDTD
QSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNFLIQQAMDPKNLSKLFSGWKAWV
NT seq 9174 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctccttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaggcagttgagaactttaggcacctgattcaagatcctgaaactgtt
cagcatttagatcagcattcagattctaaacaggggaaatatttgaattgggatgctgct
tttagatttttacagaaatatattcagaaagaaacggaatgtctaagaacagcaaaacaa
aatgtatcagcctcaacacaagccaccaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaatacttcatcaaatgtgcaaataaaagagcacctaggctaaaatgtcaagaactc
ttgaattatatcatggatacagtgagagattcatctaacaatcccatttatggagctgat
tatagcaatatattgctgaaggacattctttcagtgaggaaatactggtgtgaaatatct
cagcaacagtggcgagagttgttccttatatacttcacgctgtatcttaaaccttcacaa
gatattaatagacttttggtggctagaataattcaagctgtgaccaaaggatgctgttca
cagactgatggattgaattctgaatttttggatttttttaccaaggctattcaaaatgca
agacaagaaaagagctctcctggtctgaatcatatcttagcagcatatgttatcttcctc
aagactttggctgctaactttcgaattcgagtgtgtgaattaggagataaaattcttcct
accttactttatatttggactcaacatagacttaatgattccttaaaagaagtaattgtt
gaattatttcaactacaagtttatatgcatcatccaaagggagccaaaactcaagaaaaa
ggtgcttatgagtcagcaaagtggaaaagtatcttatacaacctatatgatctgctagtt
aatgaaataagtcgtataggaagcagagggaaatattcttctggatctcgtaatattgct
gtcaaggagaacttgattgaattgatggcagatatttgtcaccaggtttttaacgaagat
accagatctttggagatttctcagtcttacacaactacacaaagagaatttagtgattac
aatgcaccttgcaaaaagagaaaaatagaattaggctggggagtaataaaagatcatctt
cagaagtcacagaatgattttgacgttgtaccttggttacagattgcaactcagttaata
tcaaaatatcctgcaagtttacctaactgtgagctgtcaccattgctgatgatactatac
cagcttctaccgcaacagcgacgtggggagcgcacaccttacgtgttacgatgccttatg
gaagttgcattgtgtcagggcaagaaaccaaacttagaaagctcacataagtcagattta
ttgaaaatttggattaaaatttggtctataaccttccgaggtataagttctgaacaaata
caagctgaaaactttgggttacttggagccataattcaaggcagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgcaaaccttcatgtcctacagtgtgc
tgtttgactttggcattgaagacctgtgtagttccagaaacagttgaaacgggaatggag
aatatatgtgatggaaacagaaaattttctttaaaggaatcaataatgaaatggctttta
ttctgtcagttagaggatgactttgaagacagaatagagctgcctccaattcttcacagt
aattttcctcatcttgccctggagaaaattcttgtgagtctcattatgaaaaactgtaaa
gctgcaatgaattttttccaaagtgtgccagaatgtgagcaacaccaaaaagatacggaa
gaaccttcattgttagaagttgaagaactgtttcttcagacaacttttgacaagatggat
tttctaactgttgtgcaagaatgtactatagaaaagcaccaatccagtgtaggcttttct
ttccaccaaaaccttaaggaatcattggatcgctatcttctgggattgtcagaacagctt
ctaaataactacttacccgagacttcagattcagaaacgcttgtccggtgttcaagtctt
ttggtgggtgtccttggctgctattgttatgtgggtgtaatagccgaagaagaagcgtat
acatcagaattattccagaaagccaagtctctaatgcagtgtgcaggagaaagtatcact
ttgtttaaaagtaagacaaatgaggaatctagaatcatttcattgagaaatatgatgcat
ctgtgtacaaattgcttatataaatgtgctaagcgcagtccaaataagattgcatctggc
tttttcttacgattgttaacatcaaagttaatgcatgacattgcagatgtttgtagaagt
ttagcattcattatcaaaaagccatttgactgtagagaagtagaatcaatggaagatgat
actgataaaaatctgatggagatgaatgatcagtcatccatgagtctatttaatgataac
cctgctagtagtgttattgatgcaaacgaatctggagagagccaaattactatgggtgcc
atgaatcctttagctgaggaacacctctcaaagcaagatctacttgttttagacatgctc
aggtttttgtgtatgtgtataaccatcgctcagtccaatacaatgtcgtttagagcagct
gatattcggaggaaattgttgatgttaattgattctgacaggttagaccctaccaaatct
cttcacctgcacatgtatctagtacttttaaaggagcttcctggtgaagaatatcccctg
ccaatggaggatgttgttgaacttctaaaaccactatccagtgtatgttctttatatcgt
cgtgaccaagatgtttgtaaaaccattttaaaccatgtgcttcatatagtgccaaaccta
tgtcgggaaaatgtggatgccgagagcacaagggatgctcaggggcagtttctaacagtg
attggagcattttggcacttaacgaaggaggggaaatgcacattctctgtgagattggcg
ttagtaaaatgccttaaaactttgcttgaggccgatccttattcaagatgggctattctt
aatgtaatggaaaaagactttcctgtaaatgaagtatttccacaattccttgctgataat
catcaccaagtttgcatgttggctgcaggattaatcaatagattatttcagcatatgaaa
caaggagattcttccacaataatgagagcacttcctttgaaacttcagcaaacagctttt
gaaaatgcgtacttgaaagctcaggaaagaataagacaagtgaagtcccaaggaggtgag
aaccgtgaacttttggatgagatttgtaatagaaaagctgttttactgacaatgatagct
gtggtgttatgctgtagccctgtctgtgaaaaacaggctttattcgccctatgcaaatct
gtgaaagagaatggattagagcctcacctcattaaaaaggttttagagaaagtttccgaa
acttttggatatagacatttagaagactttatggcttctcatttggattatctggttttg
gaatggctacatcttcaagatgctgagtacagcttgtcttcttttccttttattttattg
aactacacaaatattgaggatttctatagatcttgctataaagttttgattccacatctg
gtgatgaggtgtcattttgatgaggtgaagtccattgctaatcagattcaaggggattgg
aaaagtcttctgacagactgcttcccaaagattcttgtaaacattcttccatactttgct
tatgaagatacaggagaccgtgggatggcacagcagagggagactgcttccaaagtctat
gatatgcttaaagatgaaaacttactaggaaaacagattgatcagttattcattaataat
ttaccagagattgtggtggagttattgatgacattacatgaaccagcaacatcagatgcc
agccaaagcactgacccctgtgacttttcaggggatttggatcctcgtcctaatccacct
cattttccatcacatgtgattaaagcaacgtttgcctatatcagcaattgccataaaacc
aagcttaaaagcattttagaagttctttccaaaagccctgattcctatcagaaaattctt
ctagctatatgtgagcaagcagctgagacaaataatgtttataaaaagcacagaatcctt
aagatatatcacctttttgttagtttattactgaaagatatgaagagtggcttaggagga
gcctgggcctttgttcttcgagatgttatttatactttgattcactatatcaacaaaaga
ccttctcgtttcatggatgtttccttgcgtagcttctccctttgttgtgacctgttgagc
cgggtttgccacacagcagtgacttactctaaggatgctttagaaagtcatcttcatgtt
attgttggtacccttataccccttgtggatggtcagatggaggttcagaaacaggtattg
gacttgctgaaatacttagtgattgataacaaggataatgaaaacctctatgtcatgatt
aaactcttagatccttttcctgacaatgctgtctttaaggatttgcgtatcactcagcag
gaaatcaaatacagtaaaggacccttttcactcttggaggaaattaaccattttctctca
gtaagtgtttatgatgcacttccattgacaagacttgaaggattgaaggatctccgaaga
cagctagcacaacataaagatcagatgatggatcttatgagagcatctcaggataaccct
caagatggcatagtggtgaagctggttgtcagcttgttgcagttatccaagatggcagta
aaccacactggtgaaagagaagttttagaggctgtcggaaggtgcctgggagaagtgggt
cctatagatttctccacaatcgctatacaacatagtaaggatatgccttataccaaagct
cttgagttatttgaagataaagaacatcattggaccctcatgatgctgacctacctgaat
agtacactggtagaagattgtgtcaaagtgcgatcagcagctgttacctgtctgaaaagc
attttagccacaaaaactggacatggtttctgggagatttttaagacgacggctgatccc
atgctgacctatcttcttccttttagaacatcaaggaaaaagtttttagaagtccccaga
ctcaacaaagaaagccctttagaaggcttggatgatattagcctgtggattcctcaaagt
gaaaatcatgacatttggataaagacactgacttgtgctcttttggatagtggaggcata
aacagtgaagttcttcagttattaaagccaatgtgtgaagtgaaaactgatttttgtcag
actgtacttccatacttgattcatgatattttactccaagataccaatgaatcatggaga
agtctgctttcaacacacattcagggatttttcactaactgtttcagacactcctcacaa
acaagccgatccacaacccctgcaaatatggattcagaatcagagcatgttttccgctgc
catttggataaaaaatcacaaagaacaatgcttgctgttgtggactacatgaggagacaa
aagagatcttcttcaggcacagtttttgacgatgctttctggctggagttgaattatcta
gaggttgccaaggtggcccagtcttgtgctgctcactttacagcattgctgtatgcagaa
atctatgcagataagaagaacatggatgatcaggaaaaaagaagccctacatttgaagaa
ggaagccaaagtacaactatttccagtttgagtgaaaaaagtaaagaagaaactggtata
agtttacaggatctgcttttagaaatctatagaagtataggagagccagatagtctttat
ggctgtggtggagggaaaatgttacagccccttactagactacgaacatatgagcatgaa
gcaatgtgggggaaagccctggtaacatatgaccttgagacagcaatctcttcatcaact
cgccaggcaggaatcattcaggccttgcagaatttagggctctgccatattctttctgtc
tatttaaaaggattagaccatgaaaataaagagcagtgtgctgaactccaggaacttcat
tatcaagtggcctggcggaatatgcagtgggacagctgcgtttctgtcaacaaaggaatg
gaaggaaccagttaccatgaatcattgtacaatgctctgcagtctctaagagatagagaa
ttctccaccttttatgaaagtctcaaatatgccagggttaaagaagtggaagagttgtgc
aagggcagccttgagtctgtgtattccctctaccccacacttagcagattgcaggccatc
ggagagcttgagaacattggggagcttttctcaagatcagtaacagataggcaaccctct
gaagtatacaataagtggtggaaacactcccagcttctcaaagacagtgattttagtttt
caagagcctataatggctctacgcacagtcattttggagatcttgatggaaaaggaaatg
gaaaactcccaaagagagtgtctcaaggacatcctcaccaagcaccttgtagaactttcc
ctactagcccgaactttccagaacactcagctccctgaaagggcaatatttcaaattaag
cagtataattcagctaattgtggagtctctgagtggcagctggaggaagcacaagtattc
tgggctaaaaaggagcagagtcttgccctgagtattctcaagcagatgatcaagaagttg
gatgccagttgtacagagaatgatcccaggctaaaacttatacacatagaatgtctacga
gtttgtggcacctggttagcagaaacttgtttagaaaatcctgcagtcatcatgcagacc
tatctagaaaaggcagtggaacttgctggaaattatgacggagaaagcaatgatgagctc
agaaatggaaaaatgaaggcatttctctctttagcacggttctcagatactcagtaccaa
agaattgaaaactacatgaaatcatcagaatttgaaaacaagcaggctcttctgaaaaga
gccaaagaggaagtgggccttcttagggaacataaaattcaaaccaacagatacacaata
aaggttcagcgagagctggagctggatgaaggtgctctccgtgcattaaaaaaggatcgt
aaacgtttcttatgtaaagcagttgaaaattacatcaattgcttattaagtggagaaggg
catgatatgtggatattccgtctttgttccctctggcttgaaaattctggagtttctgaa
gtcaatggcatgatgaagagagatggaatgaagatcccatcatataagtttttgcccctc
atgtaccagttggctgctagaatggggaccaagatgatgggaggcctaggatttcacgac
gtcctcaatagtctcatctctagaatttcagtggatcaccctcatcatactttgtttata
atattggccttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagcaaga
agtagtagaataactaaaaatacacctaaagaaagctctcagcttgatgaggatcgaact
gaggctgcaaacaaagtaatatgtactctcagaaacaggagacgtcagatggtcagaagt
gttgaagcactctgtgatgcttacattatattagcaaacttagatgccactcagtggagg
actcagagaaaaggcataaggattccagcagaccagcctattactaaacttaaaaattta
gaagatgttgttgtccctactatggaaattaaggtggaccccacaggagaatatggaaac
atggtgactatacagtcatttaaaccagaatttcgtttagcaggaggtttaaatttacca
aaaataatagattgtgtcggctctgatggcaaggaaaggcgacagcttgtcaagggccgt
gatgacctgagacaagatgcagtcatgcagcaggttttccagatgtgtaatacgttactg
cagagaaacactgaaaccaggaagaggaaactgactatctgcacatataaggtggttccc
ctttcgcagagaagtggtgttcttgaatggtgcacaggaactgtccctattggtgaatat
cttgttaacaatgacactggtgctcataaaagatacaggccaaaggatttcagtcctgtt
caatgccaaaagaaaatgatggaggcgcaaaataaatcttttgaagagaaatatgaaatc
ttcatgaatatttgccaaaattttcaaccagtttttcgttacttctgcatggaaaaattc
ttggatccagctgtttggtttgagagacgactggcttatactcagagtgtggctacgtct
tctattgttggttacatccttggacttggtgatagacatgtacagaatatcttgataaat
gagcagtcagcagaacttgtacatatagatttaggagttgcttttgaacagggtaaaatt
cttcctactcctgaaaccgttccgtttagactcacccgggacattgtggatggcatgggc
attaccggtgttgaaggggtcttcagaagatgctgtgaaaaaaccatggaggttatgaga
aactctcaggaaaccctgttaaccattgtagaggtcctcctgtatgatcctctctttgac
tggaccatgaatcctttgaaagctttgtatttacagcagagaccagaggatgaaagtgag
ctccattccactcccagagcggacgaccaggaatgcaaacggaacctcagtgatacggac
cagagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagagaaactaaaagga
gtggaggaaggaacagtgctcagtgttggtggacaggtgaatttcctgatacagcaggcc
atggaccccaaaaatctcagcaaacttttctcgggatggaaagcttgggtgtga

DBGET integrated database retrieval system