KEGG   Sus scrofa (pig): 100101927Help
Entry
100101927         CDS       T01009                                 

Gene name
IFIH1
Definition
(RefSeq) interferon-induced helicase C domain-containing protein 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc05161  Hepatitis B
ssc05162  Measles
ssc05164  Influenza A
ssc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100101927 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100101927 (IFIH1)
   05164 Influenza A
    100101927 (IFIH1)
   05161 Hepatitis B
    100101927 (IFIH1)
   05168 Herpes simplex virus 1 infection
    100101927 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ssc04054]
    100101927 (IFIH1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100101927 (IFIH1)
Pattern recognition receptors [BR:ssc04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100101927 (IFIH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_22 AAA_19 DUF3638
Motif
Other DBs
NCBI-GeneID: 100101927
NCBI-ProteinID: NP_001093664
UniProt: A7LCX1
Structure
PDB: 

Position
15
AA seq 1023 aa AA seqDB search
MSSDGYSADQNFCYLISCFRARVKRYIQVEPVLDYLTFLPAEVKEQIQRAVATTGNINAA
ELLLNTLEKGVWPPGWTRMFVQALRETGNSLAARYVNPDLTDLPSPSFESSHDECLQLLN
LLQPTVVDKLLVTDVLDKCVEEQLLTGEDRNRVSAAENDGNESGVRELLKRIVQKENWFS
TFLTVLRQTGNDALARELTGTDCCESNAESDDLLGENGPEVQEPLLLATDQPSLDVSDIE
KSSLESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEETVAQRAS
PEPELHLRPYQLEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKEASEPGKVIV
LVNKVPLVEQLFRKEFEPFLKKWYRVTRLSGDTQLKITFPEVVKSCDVIISTAQILENSL
LNSEEGEDPGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLKNNKLKKEEKPVIPL
PQILGLTASPGVGGAKKQAKAEEHILKICANLDAFTIKTVKKNINQLKDQIKEPCKKFVI
ADDTREDLFKDRLLEIMTNIQTFCQISPMSDFGTQPYEQWLIQMEKKAARDGNRKDRVCA
EHLKKYNEALQINDTIRRIDAYNHLKTFYNDEKEKKFEVLEDDSDDNGDDSDNDEDENDE
KKPSKLDESDIFLMTLFLRNKKILKKLAENPEYENEKLTKLRNTIMEHFTRTEESARGII
FTKTRQSAYALSQWITDNKKFAEVGVKAHHLIGAGHSSEFKPMTQNEQREVISKFRTGKI
NLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAQSGSGVIER
ETVNDFREKMMYKAIDRVQNMKPEEYAHKILELQMQSIMEKKMKIKRSIAKQCKDNPSLI
SFLCKNCSVLACSGEDIHIIEKMHHVNMTPEFKNLYIVRGNKALQTKFADYQTNGEIICK
KCGQAWGTMMVHKGLDLPCLKIKNYVVAFKNNLFKKQYKKWVELPITFPDLNYSEYCLSS
DED
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggatgggtattccgcggaccagaatttctgctatctcatctcgtgtttcagg
gccagagtgaaaaggtacattcaggtggagccggtattggactacttgacctttctgcct
gcagaggtgaaggagcagattcagagggcggtcgccaccactgggaacataaacgcagct
gaactgcttctgaacactttggagaagggggtctggccccccggctggactaggatgttt
gtgcaggctctccgggaaacaggcaactccttagcggcccgctacgtgaaccccgatctc
accgacttgccctctccatcctttgagagctctcatgatgagtgtctccaactgctgaac
cttcttcagcctacagtggtggacaagcttctggttaccgatgtcttggataaatgtgtg
gaggagcaactgttgacaggtgaagacagaaatcgggtttctgctgcagaaaatgatgga
aatgaatcaggagtaagggagctcctgaaaaggattgtgcagaaagaaaactggttttct
acatttctgacagttctgagacaaacaggaaatgatgcacttgcccgcgaattaacaggc
accgattgctgtgaaagcaatgcagaatctgacgatttattaggagaaaatggtcctgaa
gttcaagagcctctccttttagccacagatcagccaagtctggacgtctcggacatagag
aaaagttcactggaatcatcttttgcagattcttctgtagtttcagaatcagacacaagt
ttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatgggc
agtgattcaggcaccatgggaagtgattcagatgaagagactgtggctcaaagagcatcc
cctgagccagagctgcatctcaggccttaccaactggaagtggcccagccagctctggag
ggaaagaatatcattatatgcctccctaccgggagtgggaaaaccagagtggccgtgtac
attgccaaggatcacttggacaagaagaaagaagcttctgaacctggaaaagttatagtc
cttgtcaataaggtaccattagttgaacagctcttccgcaaagagttcgaaccatttttg
aagaaatggtatcgtgttactagattaagtggtgatacccaattgaaaataacatttcca
gaagttgtcaagtcttgtgatgttattatcagtacagctcaaatccttgaaaactccctt
ttaaactcagaagaaggagaagaccctggtgtacagctgtcagacttttctctcatcatc
attgacgaatgccatcacaccaacaaagaagcagtctataataacatcatgaggcgttat
ttgaaacagaaattgaaaaacaataaactcaagaaagaagagaaaccagtgattccctta
cctcagatattgggactaacagcctcaccaggtgttgggggagccaaaaagcaagccaaa
gctgaagaacatattttaaaaatatgtgccaatcttgatgcatttaccattaaaactgtg
aaaaaaaatattaatcaacttaaagaccaaataaaggagccatgcaaaaagtttgtaatc
gcagatgacaccagagaagatctgtttaaagatagacttctagaaataatgacaaacatt
caaactttttgccaaattagtcctatgtcggattttggaactcaaccctatgaacaatgg
ctcattcaaatggaaaaaaaagctgcaagagacggaaatcgcaaagatcgtgtttgtgca
gaacatttgaaaaagtacaatgaggctctacaaattaatgatacaatccgaaggattgat
gcctataatcaccttaaaactttctacaatgatgagaaagaaaagaagtttgaagtcctg
gaagatgacagtgatgacaatggagatgatagtgataacgatgaagatgagaatgatgaa
aagaaaccttcaaaactggatgaatcagatatatttctcatgactttatttttgagaaac
aagaaaatattgaagaagctggctgaaaacccagaatatgaaaatgaaaagctgaccaaa
ttaagaaacaccataatggaacattttacaaggactgaggaatcagcacgaggaataatt
ttcacaaaaacacgacagagtgcatatgccctttcccagtggattactgacaataaaaaa
tttgcagaagtaggagtcaaagcccaccatctgattggagctggacacagcagtgagttc
aagcccatgacacagaatgaacaaagagaagtcattagtaaatttcgcacgggaaaaata
aatctgcttatcgctaccacggtggcagaagaaggtctggatattaaagagtgtaatatc
gttattcgatatggtctcgtcactaatgaaatagccatggtccaggcccgtggtcgagcc
agagctgatgagagcacctacgtcctggttgcccaaagtggctctggagttattgaacgt
gagaccgttaatgatttccgagagaaaatgatgtataaagctatagaccgtgttcaaaat
atgaaaccagaagagtatgctcataagattttggaattacagatgcaaagtataatggaa
aagaaaatgaaaatcaagagaagtattgcaaagcaatgcaaggacaacccatcattaata
agttttctatgcaaaaactgcagtgtgctagcctgctctggagaagatatccacataatt
gagaagatgcaccatgtcaacatgacaccagagttcaagaacctgtatattgtgagagga
aacaaggcactgcagacgaagtttgctgactatcaaacaaatggcgagataatctgcaaa
aaatgtggccaagcttggggaacgatgatggtgcacaaaggcttagatttgccttgtctc
aaaataaagaattatgtagtggctttcaaaaataatttatttaagaaacaatacaaaaag
tgggtagaattacccatcacatttcccgatcttaactattcagaatattgtttgtctagt
gatgaggactga

DBGET integrated database retrieval system