KEGG   Sus scrofa (pig): 100113422Help
Entry
100113422         CDS       T01009                                 

Gene name
ACOX1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00071  Fatty acid degradation
ssc00592  alpha-Linolenic acid metabolism
ssc01040  Biosynthesis of unsaturated fatty acids
ssc01100  Metabolic pathways
ssc01212  Fatty acid metabolism
ssc03320  PPAR signaling pathway
ssc04024  cAMP signaling pathway
ssc04146  Peroxisome
Module
ssc_M00087  beta-Oxidation
ssc_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100113422 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    100113422 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    100113422 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100113422 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100113422 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100113422 (ACOX1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100113422 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 100113422
NCBI-ProteinID: NP_001094498
Ensembl: ENSSSCG00000017198
UniProt: A7J0B0
Position
12
AA seq 661 aa AA seqDB search
MNQDLQKERAAASFNPELLTHVLDGSPENTRRRREIENMILSEPDLQHEDLNFLSRSQRY
EVAVKKSATTVKKIREFGLADPDEILWFKNFVQRGHPGPLDLHVGMFLPTLLHQATEEQQ
ERFFMPAWNFKIIGTYAQTEMGHGTHLRGLETTATYDPATEEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITQGKCYGLHAFIVPIREQGTHKPLPGITVGDIGPKFGYDEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFIRSFLVGEAARCLSKACTIA
IRYSAVRHQSELRPDEPEPQILDYQTQQYKLFPFLATAYAFQFVGAYIKETYHRINENIR
QGDLSGLPELHALTAGLKAFTSWTANAAIEACRMACGGHGYSHCSGLPNIYVNFTPTCTF
EGENTVMMLQTARFLMKSYNQVHSGKLVCGMVSYLNDLPSQRIQPQQVAAWPTVADINSP
DSLIEAYRLRASRLVEIAAKNLQTEMSHRKSKEAAWNLTSIDLVRASEAHCHYVVVKLFA
EKLHQIQERSIHAVLRNLCLLYALYGISQNSGDFLQGSIMTESQVTHVNERVKELLMAIR
PEAVALVDAFDFQDVTLGSVLGRYDGNVYENMFEWAKKSPLNKTEVHESYHKHLKSLQSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggacctacagaaggagcgagccgccgccagcttcaacccggagctgctcaca
cacgtcctggacggcagtccagagaatacccggcgccgccgagagatcgaaaacatgatt
ctgagtgagccagacctgcagcatgaggacctgaacttcctcagtcgaagccagcgttac
gaggtggctgttaagaagagcgccaccacggtgaagaagataagggagtttggcctcgca
gacccagatgaaatcctgtggtttaaaaactttgtgcagcgaggacatcctgggcctctg
gatctgcacgtgggcatgttcctgcccaccttgcttcaccaggcaactgaggaacagcag
gaacgcttcttcatgcccgcctggaacttcaagatcattggcacttatgctcagacagag
atgggtcatggaactcatcttcgaggcttggaaaccacagccacttatgaccctgcaacc
gaggagttcattctcaatagccctactgtgacttccatcaagtggtggcctggtggactc
gggaagacctcaaatcacgcgatagtactggcccagctcatcacccaggggaagtgttat
ggactgcatgccttcattgtccctatccgggaacaggggacccataagcctttaccaggt
attaccgtcggggacattggccccaaattcggctatgatgagatggataatggctacctg
aagatggacaattaccgtattcccagggaaaacatgctgatgaagtatgcccaggtgaag
ccagatggcacgtatgtgaagcccctgagtaacaagctgacctacggcaccatggtgttc
atcaggtccttcctcgtgggcgaggccgcccggtgtctgtcgaaggcgtgcaccatcgcc
atccgctacagcgccgtgaggcaccagtctgaactcaggccagatgaaccagaaccacag
attttggattatcaaacccagcagtataaactctttcccttcctggccactgcctatgcc
ttccagtttgttggcgcatatataaaagagacctatcaccgcattaatgaaaacatccgc
cagggggacctgagcggcctacctgagcttcacgccctcaccgcggggttgaaggctttc
acatcctggacggctaatgctgccatcgaagcttgtcggatggcgtgtggcgggcacggc
tattctcactgcagtggacttccaaatatctatgtcaacttcaccccaacctgcaccttc
gagggagaaaacactgtcatgatgctgcagacggccaggttcctgatgaaaagttacaac
caggtgcactcaggcaagttggtgtgtggcatggtgtcctacctgaatgacctgcccagc
cagcgcatccagcctcagcaggtggcagcctggccgaccgtggcggatatcaacagccct
gacagcctgatcgaagcctatagactgcgtgcctccagactagtagaaattgctgcgaaa
aaccttcaaactgaaatgagtcacaggaagagcaaggaggcagcgtggaacctaacttcc
attgacctcgtccgagccagtgaggcacattgccactacgtggtcgtcaagctctttgcc
gaaaaactccaccagattcaggagaggtccatccacgctgtcttaaggaacctgtgtctc
ctctatgctctgtatggaatcagtcagaactcaggggattttcttcaggggagcatcatg
acagagtctcaagtcacccacgtgaacgagcgtgtgaaggaattactgatggccattcgc
cctgaagccgttgctctggttgacgcatttgattttcaggatgtgaccctgggctccgtg
cttggccgctatgacgggaatgtgtatgaaaacatgtttgaatgggccaagaaatccccg
ctaaacaaaacggaggtccatgaatcttaccacaagcacctgaagtcactgcagtccaag
ctctga

DBGET integrated database retrieval system