KEGG   Sus scrofa (pig): 100125540Help
Entry
100125540         CDS       T01009                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04064  NF-kappa B signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04380  Osteoclast differentiation
ssc04611  Platelet activation
ssc04625  C-type lectin receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc05152  Tuberculosis
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100125540 (SYK)
   04072 Phospholipase D signaling pathway
    100125540 (SYK)
   04151 PI3K-Akt signaling pathway
    100125540 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100125540 (SYK)
   04625 C-type lectin receptor signaling pathway
    100125540 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    100125540 (SYK)
   04662 B cell receptor signaling pathway
    100125540 (SYK)
   04664 Fc epsilon RI signaling pathway
    100125540 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    100125540 (SYK)
  Development
   04380 Osteoclast differentiation
    100125540 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100125540 (SYK)
  Infectious diseases
   05152 Tuberculosis
    100125540 (SYK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100125540 (SYK)
   05169 Epstein-Barr virus infection
    100125540 (SYK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100125540 (SYK)
Protein kinases [BR:ssc01001]
 Non-receptor tyrosine kinases
  SYK family
   100125540 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 100125540
NCBI-ProteinID: NP_001098422
Ensembl: ENSSSCG00000009589
Vega: OTTSUSG00000001585
UniProt: Q00655
Position
14
AA seq 628 aa AA seqDB search
MADSANHLPFFFGQITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAYDRKAHHYT
IERELNGTYAISGGRTHGSPAELCHYHSQELDGLVCLLKNPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRARDNGSYALGLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKIGGQTGNDSFRPQLPSAHPATWSAGGIISRIKSYSFPKPGHRKAS
SPQGNRPESLVSYNPYESDRGPWANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDR
KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQL
DNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEE
CNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYY
KFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTL
CWTYDVENRPGFVAVELRLRNYYYDVVN
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcagacagtgccaaccacttgcccttcttctttggccaaatcacccgggaggaggct
gaagactacctggtccaggggggcatgagcgacgggctctacctgcttcgccagagccgc
aactacctgggtggcttcgcgctgtcggtagcgtatgacaggaaggcgcatcactacacc
atcgagcgcgagttgaatgggacctatgccatctcgggcggtaggacccacggcagcccg
gccgagctctgccactaccactcccaggagctggacggcctcgtctgcctgctcaagaac
cctttcaaccggccgccaggggtgcagcccaagaccggcccctttgaggacctgaaggag
aacctcatccgggaatacgtgaaacagacatggaacctccagggtcaagccctggagcag
gcaattatcagccagaaacctcagctggagaagctgattgccaccacagcccatgaaaaa
atgccctggttccacggaaaaatctctcgggatgaatctgagcagattgtcctgatagga
tcaaagacaaatgggaagtttttgatcagggccagggacaacgggtcttatgcccttggc
ctgctgcacgaggggaaggtgctgcactaccgcatcgataaggacaaaactgggaagctt
tccatccccggcgggaagaacttcgacaccctctggcagctcgtggaacattattcttat
aaatcagatggtttgttaagagttcttacagttccatgtcaaaaaattggtgggcaaacg
ggaaatgatagttttcgtccacaacttccaagtgctcatcctgcgacttggtcagcgggt
ggaataatctcaagaatcaaatcatactccttcccaaagcctggccacagaaaggcctcc
tcgccccaagggaaccggccagagagtttggtgtcgtacaacccttacgagtcagaccga
gggccctgggccaacgaaagagaagcccagagagaagccttacccatggacaccgaggtc
tatgaaagcccctatgcagaccccgaggagatcagacccaaggaggtctacctggaccgg
aagctgctgaccctggaggacaaggaactgggctctgggaacttcgggactgtgaagaag
gggtactaccagatgaaaaaagttgtgaaaacagtggctgtgaaaatcctgaaaaatgag
gccaatgatcccgctcttaaagatgagttattagcagaagcaaacgtcatgcaacagctg
gacaacccttacatagttcgcatgatcggaatatgtgaagccgagtcctggatgctggtt
atggagatggctgaacttggtccactcaacaaatatttacagcagaacaggcacgtcaag
gataagaacatcatagagctggttcatcaggtgtctatgggaatgaaatacttggaagag
tgcaattttgtgcacagagatctggctgcaaggaatgtattgttggttactcaacattat
gccaagatcagtgactttggactctccaaagcactccgtgccgatgaaaactactataag
gcccagacccacgggaagtggcccgtgaaatggtacgctccggaatgcatcaactactac
aagttctccagcaagagcgacgtctggagcttcggagtgttgatgtgggaagcgttttcc
tatggacagaagccatatcgggggatgaaaggaagcgaagtttctgctatgctggagaaa
ggagagaggatggggtgccccccggggtgtccaagagagatgtatgagctgatgacgctg
tgctggacctatgacgtggagaacaggcctggatttgtagcggtggagctcaggctgcgc
aattactactacgatgtggttaattaa

DBGET integrated database retrieval system