KEGG   Sus scrofa (pig): 100125968
Entry
100125968         CDS       T01009                                 

Gene name
UBB
Definition
(RefSeq) polyubiquitin-B
  KO
K04551  ubiquitin B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04120  Ubiquitin mediated proteolysis
ssc04137  Mitophagy - animal
ssc05012  Parkinson disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100125968 (UBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100125968 (UBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100125968 (UBB)
   05022 Pathways of neurodegeneration - multiple diseases
    100125968 (UBB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100125968 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100125968 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100125968 (UBB)
Ubiquitin system [BR:ssc04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   100125968 (UBB)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100125968 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   100125968 (UBB)
  Exosomal proteins of colorectal cancer cells
   100125968 (UBB)
  Exosomal proteins of bladder cancer cells
   100125968 (UBB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 100125968
NCBI-ProteinID: NP_001098779
Ensembl: ENSSSCG00000018033
UniProt: A7U5U2 A0A4X1SR79
Position
12
AA seq 229 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccttgaccggcaagaccatcaccctggaggtggagcccagt
gacaccatcgagaatgtgaaggccaagatccaggataaggagggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaggatggccgcactctttctgattacaac
atccagaaagagtccaccctccatctggttctgcgtctgaggggtggtatgcagatcttc
gtgaagaccttgaccggcaagaccatcactctggaggtggagcccagtgacaccatcgag
aatgtgaaggccaagatccaggataaggaaggcattccccccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgattacaacatccagaaagag
tccactctccatctggttctgcgtctgaggggtggtatgcagatcttcgtgaagaccttg
accggcaagaccatcaccctggaggtggagcccagtgacaccatcgagaatgtgaaggcc
aagatccaggataaggaaggcattccccctgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgattacaacatccagaaagagtccactctccat
ctggtcctccgtctgaggggtggctgctaa

DBGET integrated database retrieval system