KEGG   Sus scrofa (pig): 100126280Help
Entry
100126280         CDS       T01009                                 

Gene name
CD302
Definition
(RefSeq) CD302 antigen precursor
  KO
K06722  CD302 antigen
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ssc04090]
    100126280 (CD302)
CD molecules [BR:ssc04090]
 Proteins
  100126280 (CD302)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45
Motif
Other DBs
NCBI-GeneID: 100126280
NCBI-ProteinID: NP_001103895
Ensembl: ENSSSCG00000015884
Vega: OTTSUSG00000001713
UniProt: A8WH75
Position
15
AA seq 240 aa AA seqDB search
MARAAPPALLLPLLGLAAATAAAAAAAAAVGCPSSTWVQFQDSCYIFLQEAIKVESIEDV
RNQCTDHGADMVSIHNEEENTFILETLKKQWKGPDDILLGMFFDTDDASFKWFDKSNMTF
DKWSDQEDGEDLVDTCAFLHTKTGEWKKGNCEVSSVEGTLCKAAIPYEKKYLSDNHILIS
ALVIASTVILTVLGAVIWFLYKRNLDSGFTTVFSTAPQSPFNDDCVLVVAEENEYAVQFD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggccgcgccacccgcgctcctgttgccgctgttgggcctcgccgccgccacc
gccgccgccgccgccgccgccgccgccgtgggctgcccttcatccacgtgggtgcagttc
caggacagttgttacatttttcttcaagaagccatcaaagtagaaagcatagaggatgtm
agaaatcagtgtactgaccatggggcagacatggtaagcatacataatgaagaagaaaat
acttttatactggagactttgaaaaagcaatggaaaggcccagatgatatcctactaggc
atgttttttgacacagatgatgccagtttcaagtggtttgataagtcaaatatgacattt
gataagtggtcagaccaagaagatggagaggatctagttgacacttgtgcctttctgcac
accaagacaggtgaatggaaaaaaggaaattgtgaagtttcttctgtggaaggaaccctt
tgtaaagcagctatcccatatgaaaagaaatatttatcagataaccacattttaatatca
gctttggtgatcgctagcacagtaatcttgacagttttgggagcagtcatttggttcctg
tacaaaagaaatttggactctggtttcaccacagttttctcaactgcaccccaatcacct
ttcaacgatgattgtgttttggtagttgcagaggaaaatgaatatgctgttcagtttgac
tga

DBGET integrated database retrieval system