KEGG   Sus scrofa (pig): 100134987Help
Entry
100134987         CDS       T01009                                 

Gene name
GCNT7
Definition
(RefSeq) beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Branch Interfer-bind
Motif
Other DBs
NCBI-GeneID: 100134987
NCBI-ProteinID: NP_001107171
Ensembl: ENSSSCG00000007497
Vega: OTTSUSG00000000588
UniProt: A5GFW8
Position
17
AA seq 429 aa AA seqDB search
MSQLRATKPGILVCAAIGIFVFLYLRNPTSEDPEEGPTHPAVVECGFYPDELCSALFEGK
EAALQIAKFCKDPHGSEIVARLHRPGNCSRISRELHFITRPLSAEEGTFPLAYIVTIHKE
LALFVQLLRAIYLPQNVYCIHVDAKAPKKYKTAVQSLVNCFENIFISSKREKVAYTGFRR
LQAEINCMKDLVHSKFQWSHVINLCGQDFPIKTNKDIIRYIRSKWNDKNITPGVIQPPSN
KSKTSQTHREFTPEGNIYASPNERFRDDPPHNLTIYFGSASYVLTRKFVEFVLTDTRAKD
MLRWSQDIHGPERHYWVTLNRLKDAPGSTPNAGWEGNVRAVKWRSEEGTVRDGCKGRYVQ
DSCVYGPGDLPWIIQSPSLFASQFDSAEPLVVTCLERWHRLRVLGQAEVPEEPHWHFQRE
SHLNRRLNP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctgcgagccacaaagcctggaattctcgtgtgcgcagccattggcatcttt
gtttttctttatttaaggaatccaacttctgaggacccagaggagggacccacccaccca
gcagtagtggaatgtggcttttatccagatgaattatgctcagctttgtttgaagggaaa
gaggcggccctccaaatcgcaaaattttgtaaagatcctcacggatctgaaatagttgct
cgtttacacagaccaggaaattgctccaggatttcccgggagctgcatttcataaccaga
ccgctgtctgcagaagagggtaccttccctttggcatatattgtaactattcataaggag
ctggctctgtttgtgcagctcctcagagctatttatctgccccaaaatgtttactgtatc
catgttgatgcaaaggccccaaagaagtataagactgctgtgcaatccctggttaactgt
tttgaaaatatttttatttcatcaaagagagagaaagtggcttacactggctttaggaga
ctacaggcagaaatcaattgcatgaaagatctagtccattccaaatttcaatggagccat
gtcattaatctttgtggacaggattttccgatcaaaactaacaaagacatcatacgctac
atcagaagcaaatggaatgataaaaacatcactcctggagtaatccagccaccaagcaat
aaatccaagacaagccaaactcatcgcgaattcactcccgaaggaaacatctatgcatct
ccaaatgaaagattcagagacgacccgccccataacttaacaatttactttggaagcgct
tcctatgtactcacgaggaagtttgtggagttcgtgctgacagacacccgcgccaaagac
atgcttcggtggtcccaggacatccacggcccagagcgacactactgggtgactctgaac
cgactgaaagatgctccgggttccaccccgaacgctggctgggaaggaaacgttcgcgcc
gttaaatggagaagcgaggagggaacggttcgtgacggctgtaaaggccgctacgtgcag
gacagctgtgtgtatggcccgggagacttgccctggatcattcaatcgccgtctttgttt
gccagccagtttgactccgcagagcctctggtggtcacgtgcttggagaggtggcacaga
cttagagtgctcgggcaggcagaggtccccgaggaaccgcactggcacttccagcgggag
agccatcttaataggagactgaacccctga

DBGET integrated database retrieval system