KEGG   Sus scrofa (pig): 100135659Help
Entry
100135659         CDS       T01009                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04915  Estrogen signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05200  Pathways in cancer
ssc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100135659 (NCOA3)
   04919 Thyroid hormone signaling pathway
    100135659 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100135659 (NCOA3)
   05224 Breast cancer
    100135659 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    100135659 (NCOA3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100135659 (NCOA3)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100135659 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 PAS_11 DUF4927 SRC-1 DUF1518 Nuc_rec_co-act PAS PAS_3 PAS_9 HLH PAS_4 PAS_2 DUF2953
Motif
Other DBs
NCBI-GeneID: 100135659
NCBI-ProteinID: NP_001107748
Ensembl: ENSSSCG00000007458
UniProt: B0FRD8
Position
17
AA seq 1390 aa AA seqDB search
MMSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGQGVIDKDSLGPLLLQALDGFLFVVNREGNIVF
VSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTVNGVTWTNETQRQKSHTFN
CRMLMKIPHDILEDMNTSPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTG
ERAFPSNPESFITRHDLSGKVVSIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQK
RHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHSFVSTHFLQREQNGY
RPNPNPVGQGVRPPAAGCNSSVGSMNMSPNQGLQMLSSRTYGLADPSTTGQMTGARYGAA
GSIASMNPGPGMQSPSSYQNSNYGLNMSSPPHGSPGLGSNQQNIMISPRNRGSPKMASHQ
FSPVAGVHSPMGSSGSTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNI
TQPSKVSSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESKESSVEGSENQRGPLESK
GHKKLLQLLTCSSDDRGHSSLTNSPLDSGCKDSAISVTSPSGVSSSTSGGVSSTSNMHGS
LLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCVEGNVKQEQLSPKKKENNAL
LRYLLDRDDPSDTLSKELQPKVEGVDGKMSQCSSSALPSSSQEKDSKIKTETNEEGSGDL
DNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLRSPQSVQSVRPPYNRAVS
LDSPVSVGSNPSVKNISAFPMLTKQPLMGGNPRMMDGQENYGSAMGGPNRNVAVNQTPSS
GDWGLPNSKASRMEPMNPNSMGRPGTDFNASLPRPAVGGSMPTMPLRSNSIPGARPVLQQ
QQQQQQQMLQMRPGEIPVGMGVGPYGQGAPSNQPGSWPDGMLSMEQGPHGTQNRPLLRNS
LDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQD
AFQGQEAAVMMEQKAALYGQTYPAQGPPMQGGFNLQGQSPSFNSMMNQMNQQGNFPLQGM
HPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQNRQALEMKMESPSAGGAAVMRPMMQPQ
VSSQGFLITHMVAHRSRKLLINHFRQQRVAMMMQQQQQQQQQTQAFSPPPNVTASPSMDG
VLAGPSMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPSNAMMSSRMGPSQNPMMQHPQTA
PMYQSSDMKGWPSGTLARNSSFPQQQFAPQGNPAAYSMVHMNGSSGPMGQMNMNSVPMTG
MPMGPDQKYC
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtggattaggagaaaactcgttggatccactagcccctgattcacgaaaacgc
aagttgccctgtgatactccgggacaaggccttacctgcagtggtgaaaagtggagacgg
gagcaggagagtaaatatattgaagaactggctgaactgatatctgctaatcttagcgat
attgacaatttcaacgtcaaaccagataaatgtgcaattttaaaggaaacagtaaggcag
atacgtcaaataaaagagcaaggacaaggggtgattgataaagactccttaggaccactt
ttacttcaggcgttggatggtttcctgtttgtggtgaatcgagaaggaaacattgtattt
gtgtcagaaaacgtcactcagtacctgcaatacaagcaagaagacctggttaacacaagt
gtctacagtatcttgcatgaagaagacagaaaggatttccttaaaaacttaccgaaatct
acagttaatggagttacctggacaaatgagacccagagacaaaaaagccatacatttaat
tgccgtatgttgatgaagataccacatgatatcctggaagacatgaacactagtcctgaa
atgcgccagagatatgaaacgatgcagtgctttgccctgtcccagcctcgagctatgatg
gaggagggggaagatttgcaatcctgcatgatctgtgtggcccgccgaatcactactgga
gaaagagcgtttccatcaaaccctgagagctttattactagacatgatctttcaggaaaa
gttgttagtatagatacaaattcactgagatcctccatgaggcctggctttgaagatata
atccgaaggtgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaa
cgtcactatcaagaagcttatatccatggccatgcagaaaccccagtgtatcgattctct
ttggctgatggcactatagtgactgcacagacaaagagcaaactctttcgaaatcctgta
acaaatgatcgtcacagctttgtctccacccactttcttcagagggaacagaatgggtat
agaccaaacccaaatcctgttggacaaggcgttaggcctccagcagctggatgcaacagt
tcagtaggcagcatgaacatgtcgccaaaccaaggcttacagatgctgagcagcaggacc
tatggcttggctgaccccagcaccacaggccagatgactggagctaggtatggggctgct
ggtagcatagcttcgatgaaccctggaccaggcatgcagtcaccatcttcctaccagaac
agcaactacggtctcaacatgagtagccctccgcacgggagtcctggtcttggctccaac
cagcagaatatcatgatttctcctcgtaatcgtgggagcccaaagatggcctcacatcag
ttttctcccgttgcaggtgtgcactctcccatgggatcttctggcagtactgggaatcac
agcttttctagcagctctctcagtgcccttcaagctatcagtgagggtgtggggacttct
cttttatctactctgtcttcaccaggtcccaaactggataactctcccaatatgaacata
acccaaccaagtaaagtgagcagtcaggattccaagagtcccctaggcttgtattgtgac
cagaatccagtggagagttccatgtgtcagtccaatagcagggatcacctcaatgacaag
gaaagtaaggagagcagtgtggaaggctcagagaatcaaaggggtcctctggagagcaaa
ggtcacaaaaagttactgcagttacttacctgttcctccgatgaccggggccattcctcc
ttgaccaactccccgctggattcaggatgtaaagactcggccattagcgtcaccagcccc
tctggggtctcttcttcaacctctggaggagtgtcctccacatccaatatgcatgggtca
ctgctgcaagagaagcaccggattttgcacaagttgctgcagaatgggaactcgccggcc
gaagtagccaagattactgccgaagccactgggaaagacactagtagcacagcatcttgt
gtggaaggaaacgtcaagcaggagcaactaagtcctaagaagaaggaaaataacgctctg
cttaggtatctgctggacagggatgatcctagtgacacactctccaaagaactgcagccc
aaagtagaaggcgtggacggtaaaatgagccagtgcagcagttcagcccttcctagctca
agtcaagagaaagactctaaaattaagacagaaacgaatgaagagggatctggagacttg
gataatctagatgctattcttggtgatctaactagttctgatttttataataattccata
tctacaaatggtagtaatcttggaaccaagcagcagatgtttcaaggaactaattctctg
ggtttgaggagtccgcagtctgtgcagtctgttcgtcctccatataaccgagcagtgtct
ctagatagccccgtttctgttggctcaaatccttcagtaaagaatatcagtgctttcccc
atgttaacaaagcagcccctgatgggtggcaatccaagaatgatggatggtcaggaaaat
tatggctcagctatgggtggacccaacagaaacgtggctgtgaatcagactccttcctca
ggagactggggcttacctaactcaaaggccagccgaatggagcctatgaatccaaactcg
atgggaagaccaggaacggattttaacgcctctctgcccagacctgcagtgggtggctcc
atgcccaccatgcctcttcggtccaatagcatcccaggtgcgagaccagtgttgcagcag
cagcaacagcagcagcagcagatgcttcaaatgcggcctggtgagattcccgtgggaatg
ggggtcggtccttatggccaaggagcaccatcgaaccaacctggttcctggccagatggc
atgttgtctatggaacaaggccctcatgggactcaaaataggccacttcttaggaactcc
ctggatgatctccttggaccaccttctaacctggaaggccagagtgatgaaagagcattg
ttggaccagctgcacacactcttgagcaatacagatgccacaggcttggaagaaattgac
agagctctgggcattcctgaacttgtaaatcaaggacaagctttggagcccaaacaggat
gctttccaaggccaagaagcggcagtaatgatggagcagaaggcagcattgtatgggcag
acatatccagcacaggggcctccaatgcaaggaggctttaatcttcagggacaatcacca
tcatttaactctatgatgaatcagatgaaccagcaaggcaattttcctctccaaggaatg
caccccagagccaacatcatgagacccaggacaaacacccccaagcagcttagaatgcag
cttcagcaaaggctgcagggccagcagtttttgaatcagaaccgccaagcacttgagatg
aaaatggaaagccccagtgctggtggggctgcggtgatgaggcccatgatgcagccgcag
gtcagctcccagggtttccttattacccacatggttgcccaccgcagcagaaaattgctg
attaatcacttccggcagcagagggtggcgatgatgatgcaacagcagcagcagcagcag
cagcagacgcaggccttcagtccaccccctaacgtgactgcctcccccagcatggacggg
gtcttggccgggccttcaatgccccaagctccgccccagcagtttccgtatcctccaaat
tacgggatgggacaacaaccagatccagcctttggtcgagtgtctagcccttccaatgcg
atgatgtcatcaagaatgggtccctcccagaaccccatgatgcagcaccctcagaccgca
cccatgtaccagtcctcggacatgaagggctggccctcaggaaccctggccaggaacagc
tcctttccacagcagcagtttgccccccaggggaaccctgcagcgtacagtatggtgcac
atgaatggcagcagtggtcccatgggacagatgaacatgaactccgtgcccatgaccggc
atgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system