KEGG   Sus scrofa (pig): 100141304
Entry
100141304         CDS       T01009                                 

Gene name
BLM
Definition
(RefSeq) Bloom syndrome protein
  KO
K10901  bloom syndrome protein [EC:3.6.4.12]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03440  Homologous recombination
ssc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100141304 (BLM)
   03460 Fanconi anemia pathway
    100141304 (BLM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100141304 (BLM)
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100141304 (BLM)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100141304 (BLM)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100141304 (BLM)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     100141304 (BLM)
    Bloom's syndrome complex (BTR)
     100141304 (BLM)
   FA (Fanconi anemia) pathway
     100141304 (BLM)
SSDB
Motif
Pfam: BLM_N BDHCT_assoc BDHCT DEAD RecQ_Zn_bind Helicase_C RQC HRDC ResIII
Other DBs
NCBI-GeneID: 100141304
NCBI-ProteinID: NP_001116556
UniProt: B0M1M9
Position
7
AA seq 1426 aa
MAAVPQNNLQEQLERHSARKLNNKLSLSKPKSSGFTFKKKAPSAKDLSITSVSVAKTPVL
SDKDVNVTEAFSFSEPLSHTTDQHKRINDFKNTPAGQQTKRVSSQQPLLPDLSQVPQEVL
CTSQNTPVIKESRDATFKKLEFSSSSDSCITFNDWDDMDDFDTSGNSKTFVTPLRNNFVR
VSTAQKSKKSKRNFLKSQFDKINTVKTDLIPPSSESKQAYLTKKQKDDSEWLSSDVICID
DDDPNSEEHINEDTQENRSLKTHLEEKRDNCEKEKSLEETELHSVEKSSCIELNEDDYDI
DYVPPSPEEGMTSTSSSSLKCSSMLKDLDTSDRRDGLGTSEDLSEPEKMTSQQPNPETST
DCEAGQINVQQQLIRVMDHICKLLDTIPDDKLKALDCGNELLQQRDMRRKLLAEADFNTC
DASALALLWRCRPASLGSPVASVSSPSAFPNGSSCPTGNSVKELAFPHCLSNSFSSGEHL
LTTTPGKTGFSATTKTVFERPPFNSHLQKSFVSSNWAETPRVEKRNESSYFPGNVLTSTA
VKDQNKHTTSINDLEREIQASCDIDNFDIDDFDDDDDDWENMMHNLAASKSSTAVYQPIK
EGRPVKSVSERISSAKTDSLPVASTAQNKNFSESIHNYTDKSEQNLTSRNLKHKHFQSLN
FPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSSG
VTIVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATSIYLQLSKKDPIIKLLYVTPE
KVCASNRLISTLENLYNRKLLARFVIDEAHCVSQWGHDFRPDYKRMNMLRQKFPSVPVMA
LTATANPRVQKDILTQLKILRPQVFTMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPH
DSGIIYCLSRRECDTMADTLQKDGLAALAYHAGLSDSARDEVQHKWINQDGCQVICATIA
FGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISQCLLFYTYHDVTRLKRLILME
KDGNHHTKETHFNNLYSMVHYCENIAECRRIQLLAYFGENEFNPNFCKKYPDVSCDNCCK
TKDYKTRDVTDDVKNIVRFVQEHSSSRGARNIGSSGRFTMNMLVDIFLGSKSAKLQSGIF
GKGSAYSRHNAERLFKKLILDKILDEDLYINANDQPIAYIMLGDKAQAVLNGHLKVDFME
TENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTTTLKKLAE
SLSSDPEVLLQIDGVTEDKLEKYGAEVIPILQKYSEWTVPAEDNSPRRSPSSCRGSGRNA
PEELDEETLISSHYFANKTKNERKRKRIPASQRSKRRKTSFGGSKAKGGSGTSRRISSKT
KPSNVFGSRSALLGSQAASGASRKLGIMAPPKPINRPFLKPSYAFS
NT seq 4281 nt   +upstreamnt  +downstreamnt
atggctgctgttcctcagaataatctacaggagcaactggaacgtcattcagccagaaaa
cttaataataaattaagtctttcaaaaccaaaatcttcaggtttcacttttaaaaagaaa
gcaccttcagccaaagacctatctataactagtgtgtcagtagcaaaaacacctgtgttg
agtgacaaagatgttaatgttactgaggccttttccttcagtgaacctttatcccacacc
acagatcagcacaaaaggatcaatgactttaaaaatactccagccggacagcaaactaag
agagttagttcacaacaaccgttattaccagatttgtcccaggttccacaggaagttttg
tgtaccagccagaacacaccagttataaaggaatcccgtgatgctactttcaagaaatta
gaatttagttcttcatcagattcttgtattaccttcaatgattgggatgatatggatgac
tttgatacttctggaaattcaaaaacatttgttacaccactcagaaacaacttcgtaaga
gtaagcactgctcagaaatcaaaaaaatctaagaggaactttttaaaatcacagtttgat
aaaataaatacagtaaagactgatttgattcctccatcctctgagagcaagcaggcatat
ttgactaagaaacagaaggatgattcagaatggttaagtagtgatgtgatttgcatcgat
gatgacgatcccaattccgaagagcatataaatgaagatactcaggaaaatcgctcctta
aaaactcatttggaagagaaaagagataattgtgaaaaggagaaaagcttggaagaaaca
gaattacattcagttgagaaatcttcatgtattgagctcaatgaagatgattatgacata
gattatgttccaccttctccagaagaaggaatgacttctacctcttcatcctctttaaaa
tgctctagtatgttgaaagatcttgacacctccgacagaagggatggtcttggcacatca
gaggacttgtcagaacctgagaaaatgacttcacagcaacctaatccagaaaccagcaca
gactgtgaagctggacagataaatgtacagcagcagcttatccgtgtgatggaccatatc
tgtaaattacttgataccattcctgatgacaagctgaaggctttggattgtgggaatgaa
ctgctgcagcagcgggacatgagaaggaaactccttgctgaagcagattttaacacatgt
gatgccagtgcccttgccttgctgtggagatgcaggcctgcttcacttggtagccctgtg
gcatctgtttcctcaccttctgcatttccaaatggcagttcctgtcctacagggaattct
gttaaggagttagcttttccacactgtctctcaaattccttctcttctggggagcatttg
ctgactactaccccaggaaagacaggattctcagccaccacgaagactgtctttgaaaga
cctccattcaattcccatttacagaagtcttttgtaagtagcaactgggctgaaacccca
agggtagaaaaaagaaatgaaagctcttatttcccaggaaatgttcttacaagcactgct
gtgaaagatcagaataaacacactacctcaataaatgacttggaaagagaaatccaggca
tcctgtgatattgataattttgacatagatgactttgatgatgatgacgatgactgggaa
aatatgatgcataatttagcagccagcaaatcttccacagctgtctatcaacctattaag
gaaggtcggccagtcaaatcagtatcagaaaggatttcttcagccaagacagactctctt
ccagtggcatctactgctcaaaataaaaacttctcagagtcaattcacaattacactgac
aagtcggagcaaaatttaacatccagaaatctgaaacacaagcatttccaaagtcttaat
tttcctcatacaaaagaaatgatgaagatttttcataaaaaatttggcctgcataatttt
agaactaatcagcttgaggcgatcaatgctgcactgcttggtgaagactgttttatctta
atgcccactggaggtggtaaaagtttgtgttaccagctccctgcctgtgtttcttctggg
gtcaccattgtcatttcccccttgagatcacttatagtagatcaagtccaaaagctgact
tccttggatattccagctacatatctgacaggtgataagactgactccgaagctacaagt
atttacctccagttatcaaaaaaagacccaattataaaacttctatatgtcactccagag
aaggtctgtgcaagtaacagactgatttctactctggagaatctgtacaacaggaagctc
ttggcacgttttgttattgatgaagcacattgtgtcagtcagtggggacatgattttcgt
ccagactacaaaagaatgaatatgctgcgccagaagtttccctctgttccagtgatggcg
cttacagccactgccaatcccagggtgcagaaggacatcctcactcagctgaagattctc
agacctcaggtgtttaccatgagctttaacagacataatctaaaatactatgtgttaccc
aaaaaacctaaaaaggtggcttttgattgcttagaatggatcagaaagcatcacccacat
gactcagggataatttactgcctctccaggcgagaatgtgacacaatggctgacacatta
cagaaagatggtctcgctgctctggcttatcatgctggtctcagtgactctgccagagat
gaagtacagcacaagtggattaatcaggatggctgccaggttatctgtgcaacaattgcc
tttggaatggggattgacaagcctgatgtgcgatttgtgatccacgcatccctccctaaa
tctgtggagggttactaccaagaatctggcagagctggaagagatggggaaatctcgcag
tgcctgctcttttacacctaccacgacgtgaccagactgaagaggctcatactgatggaa
aaggatggaaaccatcatacgaaagagactcacttcaataatttgtatagcatggtacat
tactgtgaaaatatagcagaatgcaggagaatacagcttttggcttactttggtgaaaat
gaatttaatcctaatttttgtaagaagtacccagatgtttcttgtgataattgctgtaaa
acaaaggattataagacaagagatgtgactgatgatgtaaaaaatattgtaagatttgtt
caagaacatagttcatcacgaggagcaagaaatataggttcttctgggagatttactatg
aatatgctggtcgacattttcctggggagtaaaagtgcaaaacttcagtcagggatattt
ggaaagggatctgcttattcacgacacaatgctgaaagactttttaaaaagctgatactt
gacaagattttggatgaagacttatatatcaatgccaatgatcaaccaattgcatatata
atgctgggagataaagcccaggctgtactgaatggtcatttaaaggtagactttatggaa
acggaaaattccagcagtgtgaaaaaacaaaaggctttagtggcaaaggtatctcagagg
gaagagatggttaagaaatgtcttggagaacttacagaagtctgcaaatctctggggaaa
gtttttggtgtccattactttaacatcttcaataccaccactctcaagaagcttgcagaa
tctttatcttctgatcctgaggttttgcttcaaattgatggtgttacagaagacaaactg
gaaaaatacggtgcagaagtgattccaatattacagaaatactccgaatggacagtgcca
gctgaggacaattccccacggagaagcccctccagctgcagaggcagtggaagaaacgcc
cccgaggagttggatgaggaaacactcatatcttctcactactttgcaaataaaaccaaa
aatgaaagaaaaaggaaaaggataccagcctcccaaaggtctaagaggagaaaaactagt
ttcggtggttccaaggcaaaaggggggtccggcacaagcagaaggatatcttctaaaact
aaaccttccaacgtatttggatcccgttcagctttgcttggttctcaagcagcatcagga
gccagtagaaaattggggattatggctccaccaaagcctataaatagaccgtttcttaag
ccttcgtatgcattttcataa

DBGET integrated database retrieval system