KEGG   Sus scrofa (pig): 100144422
Entry
100144422         CDS       T01009                                 

Gene name
ATXN3
Definition
(RefSeq) ataxin-3
  KO
K11863  Ataxin-3 [EC:3.4.22.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04141  Protein processing in endoplasmic reticulum
ssc05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100144422 (ATXN3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100144422 (ATXN3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100144422 (ATXN3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100144422 (ATXN3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     100144422 (ATXN3)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C86
   100144422 (ATXN3)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    100144422 (ATXN3)
SSDB
Motif
Pfam: Josephin SUIM_assoc UIM
Other DBs
NCBI-GeneID: 100144422
NCBI-ProteinID: NP_001116553
Ensembl: ENSSSCG00000002446
UniProt: Q06AV3 A0A4X1SNB2
Position
7
AA seq 353 aa
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IRVQQMQRPKLIGEELAQLKEQRVQKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEI
DMEDEEADLRRAIQLSMQGTSRNISQDIPQTSGTHLTSEELRKRREAYFEKQQQQQQQDP
PGPLTHPCEKPTTSSEALSSELGDAMSEEDMLQAAVTMSLETVRNNFKTEGKK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagtccatcttccacgaaaaacaagaaggctcgctttgtgctcaacattgcttgaat
aacctattgcaaggagagtacttcagccctgtggaattatcttcaattgcacaccagctc
gatgaggaagagaggatgagaatggcagaaggaggggttactagtgaggactatcgcaca
tttttacagcagccttctggaaatatggacgacagcggcttcttctctatacaagttata
agcaatgccttgaaagtgtggggtttagaactaatcctctttaacagtccagagtatcag
aggctcaggatcgatcccataaatgaaaggtcgtttatatgcaattataaggaacactgg
tttacagttagaaaattaggaaaacagtggttcaacttgaattctctcttaacgggtcca
gaattaatatcagacacataccttgcacttttcttggctcagctacaacaggaaggttat
tctatattcgtcgttaagggtgacctgccagactgtgaagctgaccaactcctgcagatg
atcagggtccagcagatgcagcgaccaaaacttattggagaagaattagcacaattaaaa
gaacagagggtccagaaaaccgatctggaacgagtcttagaagcaaatgacgggtcggga
atgttagacgaagatgaggaggatttgcagcgggctctggccctaagtcgccaggaaatc
gacatggaagatgaagaggcagatctccgcagggctattcagctcagtatgcaaggtact
tccagaaacatatctcaagatattccacagacatcaggtacacatcttacttcagaagag
ctgcggaagagaagagaagcctactttgaaaagcagcagcagcagcagcagcaagatcca
ccaggaccacttacacatccatgtgaaaagccaaccacaagttcagaagcacttagcagt
gaacttggtgatgccatgagtgaagaagatatgcttcaggcagctgtgaccatgtcttta
gaaactgttagaaataatttcaaaacagaagggaaaaaataa

DBGET integrated database retrieval system