KEGG   Sus scrofa (pig): 100144465Help
Entry
100144465         CDS       T01009                                 

Gene name
MRPS18B
Definition
(RefSeq) 28S ribosomal protein S18b, mitochondrial
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100144465 (MRPS18B)
Ribosome [BR:ssc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100144465 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 100144465
NCBI-ProteinID: NP_001116612
Ensembl: ENSSSCG00000001373 ENSSSCG00000029425
Vega: OTTSUSG00000003631
UniProt: Q767K8 L0GCT6
Structure
PDB: 

Position
7
AA seq 258 aa AA seqDB search
MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTT
HGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPL
TAPAEASSTEPGAPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccatattgaacgtgttgctgaggcgccttcctggcgtttcgcccttcaga
ggtgcctacggagttcaggttctcctccagactctttgcaccaaagctccccctgaggat
gattctttgccccaggttcccatttccccttataaagatgaaccctggaaatatctggac
tcagaagaataccagaaccgctatggttctcgccctgtctgggctgactaccgtcgcaac
cacaaaggtggaatacccccacagcggactcgaaagatgtgtattcggggaaataaagtt
gctgggaatccctgccccatctgccgggatcagaagttgcacgtcgactttaggaacgtg
aagctcttggagcagtttgtctgcgcccacacgggtatcatcttccatgccccgtacaca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagggatcat
ggtcttctcaggtaccacattccccaggttgaaccccgggaccttgacttcagtaccact
catggagctgtgagttctactccgccagcccccactctggtttcaggtgacccctggtac
ccatggtacagctggaaacagccaccagagagagagctgtcccgccttcgccggctctat
cagggccgtcttcgagaagaaagtggccctccacctgagttaatgcccgaggtgcccctt
acagccccagctgaagcctcctccactgagcctggggccccgcaaagtgctctgtag

DBGET integrated database retrieval system