KEGG   Sus scrofa (pig): 100144490Help
Entry
100144490         CDS       T01009                                 

Gene name
IGFBP4
Definition
(RefSeq) insulin-like growth factor-binding protein 4 precursor
  KO
K23576  insulin-like growth factor-binding protein 4
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100144490 (IGFBP4)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100144490 (IGFBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 100144490
NCBI-ProteinID: NP_001116601
Ensembl: ENSSSCG00000017472
UniProt: P24854
Position
12
AA seq 259 aa AA seqDB search
MLPLCLVAALLLSASGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATC
ALGKGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGLCMELAEIEAIQESLQPSDKD
EGDHPNNSFSPCSPQDRRCLQKHLAKIRDRSTSGGKMKVIGAPREEARPVPQGSCQSELH
RALERLAASQRRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPG
GLEPKGELDCHQLADSFRE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccctgtgcctcgtggccgcgctgctgctgtcggcctccgggccccggccgagc
ctgggcgacgaagccatccactgcccgccctgctccgaagagaagctggcgcgctgccgc
ccccccgtgggctgcgaggagctggtgcgagagccgggctgcggctgttgcgccacttgc
gccctgggcaaagggatgccctgcggggtgtatacaccccgctgtggctctggcctgcgg
tgctacccgccccggggcgtggagaagcccctgcacacgctgatgcacgggcaaggcctg
tgcatggagctggcagagatcgaggccatccaggaaagcctgcagccctctgacaaggac
gagggtgaccaccccaacaacagcttcagcccctgcagcccccaagaccgcaggtgcctg
cagaagcacttggccaagatccgagaccggagcaccagtgggggcaagatgaaggtcatc
ggggcacctcgggaggaagcccggcctgtgccccagggctcctgccagagtgagctgcac
cgggccctggagcggctggccgcctcgcagagacgcacccatgaggacctctacatcatc
cccatccccaactgcgaccgcaacggcaacttccaccccaagcagtgccacccggccctg
gatggtcagcgcggcaagtgctggtgtgtggaccggaagacgggagtgaagcttccgggg
ggcctggagccgaagggggagctggattgccaccagctggccgacagcttccgagagtga

DBGET integrated database retrieval system