KEGG   Sus scrofa (pig): 100152067
Entry
100152067         CDS       T01009                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc01100  Metabolic pathways
ssc01522  Endocrine resistance
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04114  Oocyte meiosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04371  Apelin signaling pathway
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04713  Circadian entrainment
ssc04714  Thermogenesis
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04727  GABAergic synapse
ssc04742  Taste transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04913  Ovarian steroidogenesis
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04921  Oxytocin signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc04976  Bile secretion
ssc05032  Morphine addiction
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100152067 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100152067 (ADCY4)
   04371 Apelin signaling pathway
    100152067 (ADCY4)
   04020 Calcium signaling pathway
    100152067 (ADCY4)
   04072 Phospholipase D signaling pathway
    100152067 (ADCY4)
   04024 cAMP signaling pathway
    100152067 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100152067 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100152067 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100152067 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100152067 (ADCY4)
   04062 Chemokine signaling pathway
    100152067 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100152067 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100152067 (ADCY4)
   04912 GnRH signaling pathway
    100152067 (ADCY4)
   04913 Ovarian steroidogenesis
    100152067 (ADCY4)
   04915 Estrogen signaling pathway
    100152067 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100152067 (ADCY4)
   04921 Oxytocin signaling pathway
    100152067 (ADCY4)
   04926 Relaxin signaling pathway
    100152067 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100152067 (ADCY4)
   04918 Thyroid hormone synthesis
    100152067 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100152067 (ADCY4)
   04916 Melanogenesis
    100152067 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100152067 (ADCY4)
   04927 Cortisol synthesis and secretion
    100152067 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100152067 (ADCY4)
   04270 Vascular smooth muscle contraction
    100152067 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100152067 (ADCY4)
   04971 Gastric acid secretion
    100152067 (ADCY4)
   04972 Pancreatic secretion
    100152067 (ADCY4)
   04976 Bile secretion
    100152067 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100152067 (ADCY4)
   04727 GABAergic synapse
    100152067 (ADCY4)
   04725 Cholinergic synapse
    100152067 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100152067 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100152067 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100152067 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100152067 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100152067 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100152067 (ADCY4)
   04714 Thermogenesis
    100152067 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100152067 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100152067 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100152067 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100152067 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100152067 (ADCY4)
   05163 Human cytomegalovirus infection
    100152067 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100152067 (ADCY4)
Enzymes [BR:ssc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100152067 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100152067
NCBI-ProteinID: XP_001927591
Ensembl: ENSSSCG00000001988
Position
7
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLFGLLALLAVAWASGRELASDPG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHGFLFTGGLVSAWDQV
SFFLFVIFTVYAMLPLGMRDAAAAGLVSSTSHLLALGLYLGPQPGSRPALLPQLAANAVV
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAVMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTPRGFDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAITYGIAFLLFFLLLFICFSEYLTKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLIFAMAIASLVFLPVASHCPFQAPNVSSMAFNLSWELPGSLPLISVPY
SMHCCMLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLVARLYQGTLDS
RPGVLKDPKLMGAVSFFVFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctactgctgctggtgatcgtgctcttcggg
ctcctggcactgctcgctgttgcctgggccagtggcagggagctggcctcagacccaggg
ttcctgaccactgtgctgtgcgctctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgactgcagcgttggactcgtcccctgtccggcctcgtgtgggcagcgctg
cttgcgctaggccacggcttcctgttcacggggggcttggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcaccgtgtatgccatgttgcccttgggcatgcgggac
gccgccgctgcgggccttgtctcctcgacctcacacctgctggccctcgggctgtatctt
gggcctcagccaggctcacggcctgcgctgctgcctcagctggcagcaaatgcagtggtg
ttcctgtgcgggaacgtggctggagcctaccacaaggcgctgatggagcgcgccctacgc
gccacattccgggaagcgcttagttccctgcactcgcgccggcggctggatacggagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccaagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagtgaatgctcccccaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgtatgcggatcaagatcttg
ggagactgttattactgtgtctccgggctaccactctcgctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgtgccatcaggaaacttcgagcagccaccggt
gtggatatcaacatgcgtgtgggcgtgcactcgggcagcgtgctctgcggagttattggg
ctgcagaaatggcagtatgatgtctggtcccatgacgtcactctggccaaccacatggag
gcgagtggagtgccaggacgggtacatatcacaggggctacgctggccctgctggcagga
gcctatgctgtggaggatgcagtcatggaacaccgggacccataccttcgggagctaggg
gaacctacctacctggtcatcgatccccgggctgaggaggaggacgagaagggcactgca
ggaggattgctgtcctccctcgagggccccaagatgcgtccatcgctgctgatgacccga
tacctggagtcctggggtgcagccaagcctttcgcccacctgagccacgtagagagccct
gtgtccacctccacccccctcccggagaaggccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggattcgatgacgaactggacaccggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaaacagtcaaaggacttc
aacccactgacactgtacttcagagaaaaggagatggagaaagagtatcggctctccgca
ctccccgccttcaaatactatgcagcctgcaccttcctggtttttctgtccaacttcatc
atccagatgctggtgacaaacaggcctccagctctggccatcacctatggcatcgccttc
ctcctcttcttcctcctcctcttcatctgcttctcagagtacctgacgaagtgtgtcttg
aaaggccccaagatgctacactggctgcccacactgtctgtcctggtggccacacggcct
ggactgcgagttgccctgggtaccgccaccatcctgctcatctttgccatggccattgcc
agcctggtcttcctaccggtggcatcacactgccctttccaggctcccaatgtgtcctcc
atggctttcaacctctcctgggagctccctggatccctgcctctcatcagtgtcccttac
tccatgcactgctgcatgctgggcttcctctcctgctccctcttcctacacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcctcctgctccctcttcctgcac
tcccacgcctggctgtccgactgcctcgtcgcccgcctctaccagggcaccttggactcc
aggccaggggtgctgaaggatcccaagttgatgggagcagtctccttctttgtcttcttc
ttcaccctcctggtcctggctcggcagaatgagtattactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacaatggagaacctgactcgcttg
ctcttggagaacgtgctccccgcgcacgtggccccccagttcattggccagaatcggcgc
aacgaggacctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagtccca
gactttaaggagttttactctgaatccaacatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagatcattgctgattttgatgagctactctccaagcccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagctacaggcttgaatgccacc
tctggacaggacacccagcaggatgctgagcgaagttgcagccaccttggcaccatggtg
gaatttgccgtggcccttgggtctaagctggacgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggttaaaccatggacctgtagtggccggagtgattggggcacag
aagccacagtatgacatctggggcaacacggtgaacgtggccagccgcatggagagtaca
ggcgtcctgggcaagatccaagtgactgaagagacagcctgggccctgcagtccttaggc
tacacctgctacagccggggtatcatcaaggtcaaaggcaaaggacagctctgcacctac
ttcctgaacacagatttaacacgaactggacctccttcagccaccctaggctga

DBGET integrated database retrieval system