KEGG   Sus scrofa (pig): 100152243Help
Entry
100152243         CDS       T01009                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100152243 (MINPP1)
   00562 Inositol phosphate metabolism
    100152243 (MINPP1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100152243 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100152243 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 100152243
NCBI-ProteinID: XP_001927707
Ensembl: ENSSSCG00000010435
UniProt: F1SCZ6
Position
14
AA seq 485 aa AA seqDB search
MLPLPGRIFRVRVAPVAALAVALVSSLSRCSLLEPENRVVSALSPYFGTKTRYEDANPGL
LPDPEVPRRDPELLEETCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARAPDKGTRA
AGGRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLVT
SSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVER
NATALYHVEAFKTGPEMQNILKKVAAILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSPW
CDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQNIFQHLDKAIEQKQSSQPVS
SPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYH
CKNAKTPKEEFRVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCQTTEDCELPKVN
TSDEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgcttcccggccgaatcttcagggttcgcgtagcacctgtcgcggccctggct
gtggcgctggtctcgtcgctttctcgctgctccctcctggagccggagaaccgcgtggtc
tcggcgcttagcccctacttcggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaggtcccgcggcgggacccggagctattggaggagacctgcacccct
gtgcagctggtcgccctcatccgccatggcacccgctacccgacggccaaacaaatccgc
aagctgcggcagctgcacgggctactgcaggcccgcgcgccggataaggggacccgcgct
gccggcggccgcgacctgggcgccgcgctggccgactggccgttgtggtacgcggactgg
atggatgggcagctggtggagaaagggcggcaggacatgcgacagctggcgctgcgcctg
gcctcccttttcccggcccttttcagccgggagaactacggccgcctgcagctagtcacc
agctccaagcaccgctgcgtggacagcggcgccgccttcctacaggggctgtggcagcac
taccacccggggttgccgccgcccgacgtcgcagatatggagtgtggacctccaagaatt
aatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaaagg
aatgctacggctctttatcatgtagaagccttcaaaactggaccagaaatgcagaacatt
ttaaaaaaagttgcagctattttgcaagtaccagtcaataatttaaatgcagatttaatt
caggtagcttttttcacctgttcatttgacctggcaattaaaggtgttaaatctccttgg
tgtgatgtttttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaacaa
tattggaaaagaggatatgggtatactattaacagtcgctccagctgcaccctgtttcag
aatatctttcagcacttggacaaagcaattgaacagaagcaaagttctcagccagtttcc
tctccagtcatccttcagtttggtcatgcagagactcttcttccactgctttctctcatg
ggctacttcaaagacaaggagcccctcacagcttataattataaagagcaaatgcatcga
aagttccgaagtggtcacattgtaccctatgcctcaaacctaatatttgtgctttaccat
tgtaaaaatgccaagacacctaaagaagaattccgagtgcagatgttactgaatgaaaag
gtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaaccac
tataaggacatccttcagagttgtcagaccactgaagattgtgaattaccaaaagtgaac
acatctgatgagctttga

DBGET integrated database retrieval system