KEGG   Sus scrofa (pig): 100152368
Entry
100152368         CDS       T01009                                 

Gene name
EGLN3
Definition
(RefSeq) egl nine homolog 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04066  HIF-1 signaling pathway
ssc05200  Pathways in cancer
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100152368 (EGLN3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100152368 (EGLN3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100152368 (EGLN3)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     100152368 (EGLN3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 100152368
NCBI-ProteinID: XP_001928542
UniProt: F1SHH1
Position
7
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLLDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTEPALTED
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcccctaggacacatcatgaggctggatctggagaaaatcgccctggagtatatcgtg
ccctgtctgcacgaggtcggcttctgctacctggacaacttcttgggcgaggtggtgggc
gattgtgtcctggagcgcgtcaagcagctgcactgcaccggggccctgcgggacggccag
ctggccgggccccgcgcgggcgtttccaagcggcacctgcggggcgaccagatcacgtgg
atcggaggcaacgaggaaggctgcgaggccatcagcttcctcctgtccctcctcgacagg
ctggtcctgtactgcgggagccggctgggcaaatactacgtcaaggaaaggtccaaggcg
atggtggcttgctacccaggaaatggaacaggttacgttcgacatgttgacaaccccaac
ggcgacggccgctgcatcacctgcatctactatctgaacaagaattgggatgccaagcta
cacggtgggatcctgcggatatttccagaagggaaatcattcatagcagatgtggagccc
atttttgacagactcttgttcttctggtcagaccgcaggaacccacatgaagtccagcct
tcctatgcgaccagatatgccatgactgtttggtacttcgatgctgaagagagggccgaa
gccaaaaagaaattcaggaatttgactaggaaaaccgagcctgccctcactgaggactga

DBGET integrated database retrieval system