KEGG   Sus scrofa (pig): 100152419Help
Entry
100152419         CDS       T01009                                 

Gene name
FRZB
Definition
(RefSeq) secreted frizzled-related protein 3 precursor
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR DUF3774
Motif
Other DBs
NCBI-GeneID: 100152419
NCBI-ProteinID: NP_001230259
Ensembl: ENSSSCG00000016018
UniProt: A0A4X1SQG3 S5Y9V4
Position
15
AA seq 325 aa AA seqDB search
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPESLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEVKIKCHDVTAVVEVKEILKASLVNIPKDTVNLYTS
SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDTKLRHLGLNK
SDSSQSDSTQSQKSGRSSNPRQARN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctgcggcagcccaggaggcatgctgttgctgcgggctgggctgcttgccctggcg
gcgctctgcctgctccgcgtgcctggagcccgggctgcagcctgtgagcccgtccgcatc
cccctgtgcaagtctctgccatggaacatgaccaagatgcccaaccacctgcaccacagc
actcaggccaacgccatcctggccatcgagcagttcgaaggtctgctgggcacccactgc
agcccggatctgctcttcttcctctgtgccatgtacgcgcccatctgcaccattgacttc
caacacgagcctattaagccctgcaagtctgtgtgcgagcgggcccggcagggctgtgag
cccattctcatcaagtaccgccactcgtggccggaaagcctggcctgcgaagagctgccg
gtttatgaccgtggcgtatgcatctctccagaggccattgtcactgccgatggagcagat
tttcctatggattctagtaatggaaactgtagaggggcaagcagtgaacgctgcaaatgt
aaacctattagagctacacagaagacctatttccgaaacaattacaactatgtcattcgt
gctaaagttaaagaagtaaagatcaagtgccatgatgtgactgcagtagttgaggtgaag
gagattttaaaggcttccctggtcaacattccaaaggacactgttaacctttacaccagc
tctggctgcctgtgtcctccacttaacgtcaatgaggagtatatcatcatgggctatgaa
gatgaggaacgctccagattactgttggtggaaggttctattgctgagaaatggaaggat
cggcttggtaaaaaagttaagcgctgggatacgaagctccgtcatctaggactgaataaa
agtgattctagtcagagtgattccacccagagtcagaaatctggcaggagctctaaccct
cggcaagcacgcaactga

DBGET integrated database retrieval system