KEGG   Sus scrofa (pig): 100152542Help
Entry
100152542         CDS       T01009                                 

Gene name
LPCAT4
Definition
(RefSeq) lysophospholipid acyltransferase LPCAT4
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00564  Glycerophospholipid metabolism
ssc00565  Ether lipid metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100152542 (LPCAT4)
   00565 Ether lipid metabolism
    100152542 (LPCAT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ssc01004]
    100152542 (LPCAT4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     100152542 (LPCAT4)
    2.3.1.-  
     100152542 (LPCAT4)
Lipid biosynthesis proteins [BR:ssc01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100152542 (LPCAT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase JmjN
Motif
Other DBs
NCBI-GeneID: 100152542
NCBI-ProteinID: NP_001139339
Ensembl: ENSSSCG00000002235
UniProt: C0KEG5
Position
7
AA seq 524 aa AA seqDB search
MSQGSPGDWAPLDPTPGPPAPAPPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLTEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRATRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYRPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSPGCADTGAEPGRSRMISQEEF
ARQLQLSDPQMVAGAFSYFQQDASGLVDFRDVTLALAALDGSRNLEELTCLAFELFAEEQ
AEAPGRLLYKDGFSTILHLLLGSPRPAAVALHAELCQAGPRQGLSLCQFQEFSLHHPLHG
KLFSTYLRPSQTPDAPSQTPDASSPGSTPALANGTVQAPKQKGD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagccagggaagtccgggggactgggccccccttgaccccacccccggacccccagcg
cccgccccccccttcgtgcatgagttacatctctcccgcctccagagggttaagttctgc
cttctgggggcactgctggcccccatccgagtgcttctggcctttatcgtcctctttctc
ctctggccctttgcctggctgcaagtagctggccttactgaggaacaacttcaggagccg
attacaggatggaggaagaccgtatgccacaatggggtgctgggcctcagccgtctgctc
tttttcctgctgggtttcctccggatccgagttcggggccagcgggccactcgccttcaa
gcccctgtcctagttgccgccccccactctactttctttgaccccattgttctgctgccc
tgtgacctgcccaaagttgtgtctcgagctgagaacctttccgttcctgtcattggagcc
cttcttcgcttcaaccaagccatcctagtatccaggcatgacccagcttcccggcgcaga
gtggtggaggaggtccgtaggcgggctacctcaggaggcaagtggccgcaggtattattc
tttcctgagggcacctgttccaacaagaaggctctgcttaaattcaaaccaggagccttc
attgcaggcgtacctgtgcagcctgtcctcatccgctaccccaacagtctggacaccacc
agctgggcatggaggggccctggagtactcaaagtcctctggctcacagcctctcagccc
tgcagcatcgtggatgtggagttcctccctgtgtatcgccccagcccagaggagagcagg
gaccccaccctctatgccaacaatgtccagagggtcatggcacaggccctgggcattcca
gccactgagtgcgagtttgtagggagcttacctgtgattgtggtgggccggctgaaggta
gcactggagccacagctatgggaactgggaaaggtacttcggaaggctgggctgtcccct
ggctgtgcggacactggggcagagccaggccggagtcgaatgatcagccaggaagagttt
gccaggcagctacagctttctgatccccagatggtggctggtgcctttagctacttccag
caggatgccagtggtttggtggacttccgagatgtcacgctcgcattggcagctctggat
gggagcaggaacctagaggagctgacttgcctggccttcgagctttttgccgaggagcag
gccgaggcgcctggccgcctgctgtacaaggacggcttcagcaccatcctgcacctgctg
ctggggtcgccccgccctgccgccgtggctttgcatgccgagctatgccaggccggaccc
cgccagggcctctccctctgtcagttccaggaattctccctccaccacccgctccacggg
aagctcttcagcacctatctgcgcccttcccagacaccagacgccccttcccagacacca
gacgcctcctccccaggcagcacccccgccctggccaacgggactgtgcaggcccccaag
cagaagggtgactga

DBGET integrated database retrieval system