KEGG   Sus scrofa (pig): 100152554
Entry
100152554         CDS       T01009                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ssc01100  Metabolic pathways
Module
ssc_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100152554 (B3GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100152554 (B3GALT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     100152554 (B3GALT1)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  Type 1 chain
   100152554 (B3GALT1)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 100152554
NCBI-ProteinID: XP_013839674
Ensembl: ENSSSCG00000015918
UniProt: A0A287B819 A0A4X1VGL2
Position
15
AA seq 326 aa
MASKVSCLYVLTVVCWASALWYLSVTRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcttcaaaggtgtcctgcttatatgttttgacagttgtgtgctgggccagcgctctc
tggtacttgagtgtaactcgccctacttcttcctacactggctccaagccgttcagccat
ctaacggttgctaggaaaaatttcacctttggcaacataagaactcgacccataaacccc
cattcttttgagtttcttatcaatgagcccaacaaatgtgagaaaaacattcctttcctc
gtcatcctcatcagcaccacccataaagaatttgatgcccgccaggcaatccgggagacc
tggggggatgagaacaactttaaggggatcaagatcgccaccctcttcctcctgggcaag
aacgcggatcctgtgctcaaccagatggtggagcaagagagccaaatctttcacgacatt
attgtggaggacttcattgattcctaccataacctgaccctcaaaacattaatgggcatg
agatgggtggccactttctgttcgaaagccaagtacgtcatgaagactgatagtgacatt
tttgtcaacatggacaaccttatttataagctgctaaagccctccaccaagccaagaaga
aggtatttcaccggctatgtcatcaacggagggcccatccgggacgtccgcagtaagtgg
tacatgcccagggatttgtaccccgacagtaactacccacccttctgttcggggaccggc
tatatcttttcagctgatgtggctgaactcatttacaagacctccctccacacaaggctg
cttcaccttgaagacgtctatgtgggattgtgtcttcgaaagctgggcatacatcctttc
cagaacagtggcttcaatcactggaaaatggcctacagtttgtgtaggtatcgccgagtt
atcaccgtgcatcagatctctccagaagaaatgcacagaatctggaatgacatgtcaagc
aagaaacatctccgatgttag

DBGET integrated database retrieval system