KEGG   Sus scrofa (pig): 100152681
Entry
100152681         CDS       T01009                                 

Gene name
TOX4
Definition
(RefSeq) TOX high mobility group box family member 4
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: HMG_box HMG_box_2 YABBY
Other DBs
NCBI-GeneID: 100152681
NCBI-ProteinID: XP_001929153
Ensembl: ENSSSCG00000029203
UniProt: I3LAV9 A0A4X1UWA5
Position
7
AA seq 620 aa
MEFPGGSDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFD
DLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANP
PVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPT
SSLHEDGVEEFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAA
IKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATV
ETVELDPAPPSQTPSPPPVATTADPASPAPATTEPPALSPSIVVNSTLSSYVTNQASSGA
GGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIV
TRSVLQAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKFR
INLQQQPPPLQVKIVPPPTLKMQTTLVPPPVENSPEQPMNSSPEAHTVEETSPETICEMI
TDVVPEVESPPQMDVELVDESPVTLSPQPRCVRSGCENPPVVSKDWDNEYCSNECVVKHC
RDVFLAWVASRNSNTVVFVK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggagtttcccggaggaagtgacaattacctgacgatcactggaccctcgcaccccttc
ctgtcaggggccgagacgttccatacaccaagcttaggcgatgaggagtttgaaatccca
cccatctccttggattctgatccctcactggctgtctcggatgtggttggacactttgat
gacctggcagacccttcctcctctcaggatggcagcttttcagcccaatatggggtccag
acattggacatgcctgtgggcatgacccatggcttgatggagcagggcggggggctcctg
agtgggggcttgaccatggacttggatcattctataggaactcagtatagcgccaaccca
cctgttacaattgatgtaccaatgacagacatgacatctggcttgatggggcatagccag
ttgaccaccattgatcagtcagaactgagttctcaacttggtttgagcttagggggtggc
accatcctgccacctgcccagtcacctgaggatcgtctttcaaccaccccttcacctact
agttcacttcatgaggatggtgttgaggaattccggaggcaacttcccagccagaagaca
gttgtggtggaagcagggaaaaagcagaaggctccaaagaagagaaaaaagaaagatcct
aatgaacctcaaaaaccagtttcagcatatgctttgttctttcgtgacacacaagctgcc
atcaagggacagaatcccaatgccacttttggggaggtttcaaaaattgtggcctccatg
tgggacagtcttggagaggagcaaaagcaggtgtacaagaggaaaactgaagctgccaag
aaagagtatctaaaggctctggctgcttataaagataatcaggagtgtcaggccactgta
gaaacagtggaattggatccagcaccaccatcgcagactccttctccacctcctgtggct
acaactgctgacccagcatctccagcaccagccacaacagagcctccggccctgtctcct
tccattgttgttaattccactctttcatcctatgtgacaaaccaagcatcttctggagct
gggggtcagcccaatattaccaagttgattattaccaaacagatgttgccttcttctatt
actatgtctcaaggagggatggttaccgttatcccagcaacagtggtgacctcccggggg
ctccaactaggccaaaccagtacagctactatccagcctagtcaacaagcccagattgtc
actcggtcagtgttgcaggcagcagcagcagcagcagcttctatgcaactgcctccaccc
cgactacaaccccctccattgcaacagatgcctcagccccccactcagcaacaagtgacc
attctgcagcagcctcccccactccaggccatgcaacagcctccaccacagaaatttcga
atcaatttacagcaacagccacctccgctgcaggtcaagattgtgcctccacccactctg
aaaatgcagactaccttagttccaccacctgtagaaaatagtcctgagcagcctatgaac
agcagccctgaggcccatactgtggaggaaacctctcctgagacaatctgtgagatgatc
acagatgtagttcctgaggttgagtctcctccccaaatggatgttgaattggtggatgag
tctcctgtgacgctctcaccccagcctcgatgtgtgaggtccggctgtgagaaccctcct
gttgtgagtaaagactgggacaacgagtactgcagcaatgagtgcgtggtgaagcactgc
agggatgtcttcttggcctgggtagcctctagaaattcaaacacagtggtgtttgtgaaa
tag

DBGET integrated database retrieval system