KEGG   Sus scrofa (pig): 100152714
Entry
100152714         CDS       T01009                                 

Definition
(RefSeq) carbonic anhydrase 13 isoform X1
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00910  Nitrogen metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    100152714
Enzymes [BR:ssc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     100152714
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 100152714
NCBI-ProteinID: XP_001924497
Ensembl: ENSSSCG00000006143
UniProt: F1RXC0 A0A4X1UGB0
Position
4
AA seq 262 aa
MSRFSWGYGEHNGPVHWNEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFSVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVKYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEHNSQLQKITDILDSIKEKGKQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIILKQPINISSQQLATFRTLLCTKEGEEAA
FLLSNHRPLQPLKGRKVRASFH
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcgaggttcagctggggatacggcgagcacaacggtcctgttcattggaatgaattt
tttcctattgctgatggggatcaacaatctccgattgagattaaaaccaaagaagtgaaa
tatgactcttccctcagacctcttagtatcaagtatgacccaagctcagctaaaatcatc
agtaatagtggccactccttcagcgttgactttgatgacacagaggacaaatcagtgctg
cgtgggggtcccctcactggaagctacaggttacgacagtttcaccttcactgggggtct
gctgatgatcacggctcagaacatgtggtggatggagtaaaatatgccgcagagctccat
gttgttcattggaattcagacaaataccccagctttgttgaggcagctcatgaaccagat
ggactggctgtcttgggggtatttttgcagattggtgagcataattctcaactgcaaaag
attactgatattttggattccattaaagaaaagggtaaacaaactcggttcacgaatttt
gatccattatctctgcttcctccatcctgggattattggacatatcctggttcccttaca
gtcccacctcttctcgagagtgtcacctggatcattttaaaacaacctataaacatcagc
tctcagcagttggccacattccgtaccctcttgtgtacaaaggagggtgaagaggcagcc
tttttgttgagcaaccaccgtcctctacagcctctgaagggccggaaagtgagagcctct
ttccattaa

DBGET integrated database retrieval system