KEGG   Sus scrofa (pig): 100152927Help
Entry
100152927         CDS       T01009                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00564  Glycerophospholipid metabolism
ssc00565  Ether lipid metabolism
ssc00590  Arachidonic acid metabolism
ssc00591  Linoleic acid metabolism
ssc00592  alpha-Linolenic acid metabolism
ssc01100  Metabolic pathways
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04217  Necroptosis
ssc04270  Vascular smooth muscle contraction
ssc04370  VEGF signaling pathway
ssc04611  Platelet activation
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04724  Glutamatergic synapse
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04912  GnRH signaling pathway
ssc04913  Ovarian steroidogenesis
ssc04921  Oxytocin signaling pathway
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100152927 (PLA2G4B)
   00565 Ether lipid metabolism
    100152927 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100152927 (PLA2G4B)
   00591 Linoleic acid metabolism
    100152927 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100152927 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100152927 (PLA2G4B)
   04010 MAPK signaling pathway
    100152927 (PLA2G4B)
   04370 VEGF signaling pathway
    100152927 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100152927 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100152927 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100152927 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100152927 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100152927 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100152927 (PLA2G4B)
   04913 Ovarian steroidogenesis
    100152927 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100152927 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100152927 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100152927 (PLA2G4B)
   04726 Serotonergic synapse
    100152927 (PLA2G4B)
   04730 Long-term depression
    100152927 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100152927 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100152927 (PLA2G4B)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100152927 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100152927
NCBI-ProteinID: NP_001191329
Ensembl: ENSSSCG00000004737 ENSSSCG00000024969
UniProt: A0A4X1V0R9 F1SSW8
Position
1
AA seq 780 aa AA seqDB search
MALAKVPGTCLLTIRVLQAHGLPSKDLVSPSDCYVTLWLPTASSHQLQTRMVKNSRNPIW
NQSFHFRIHSQLKNVVQLKVFDQDFLTKDDPMLSVLFDVGTLRAGESRRESFSLNPQGEE
RLEVEFRLQSLTDCEQLVSNGILVARELSCLHVRLEKAGDQKESEGRVQLVVPGSCEGPQ
EASVGTGPWHFHWPACWEQELRIHLQDAPQEQLKVPLRALPSGQVVRLVFPTSQEPMMRV
ELENKEGPRELAVRLGCKPCAEEQAFLSRRKQVVAKALKQALQLDGDLQEDEIPVIAVMA
TGGGTRAMTSLYGQLAGLKELGLLDCISYITGASGATWALANLYEDPEWSQKDLVGPIES
LKTQVTKSKLGVLAPSQLWRYRQELAERARLGYPTCFTDLWALVSEALLHDQPHDHKLSD
QREALSHGQNPLPIYCALNTKEKGLTTFEFGEWCEFSPYEIGFPKYGAFIPSELFGSQFF
MGRLTKQLPESRICFLEGIWSNLYTANLQDSLYWSSEPSQFWDRWAQDQISLDKDQVPLL
KVEEPPTVAGRIAEFFTDLLTWRPLAQTTHNFLRGLSFHKDYYQHPHFSAWKATKLDGFP
NQLTPAEPHLCLLDVGYLINTSCPPLLRPTRDVDLILSLDYNLHGAFQQLQLLGQFCQEQ
GIPFPPISPSPEEQCQPQECHLFLDPACPDAPAVLHFPLVNASFREHSAPGVRRTAEEQE
AGQVNLSSSDSPYHFSKVTYSQEDTDKLLRLTQYNICNNRERLLEALREAVQRRRQRRPE
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcttgctcaccattcgtgtcctgcaggcccat
ggcctgccctccaaggacctagtgagcccctctgactgctatgtgactctgtggctgccc
acggcctccagccaccagctccagacacgcatggtcaaaaacagcagaaatcccatctgg
aatcagagctttcacttccgaatccacagccaactcaagaacgtcgtgcaactcaaagtc
tttgaccaggacttcctgaccaaggatgaccccatgttgtcagtgctgtttgacgtgggg
actttgcgggctggggagtcgcggcgcgagagcttctcattgaaccctcagggtgaggag
cggctagaagttgaatttcggctgcagagtctaactgattgtgagcagctcgtcagcaac
ggcatcctggtggcccgggagctctcctgcttgcatgttcgactagagaaggctggagac
cagaaggagtcagagggcagagtgcagcttgtggttcctgggtcctgtgagggtccacag
gaggcctctgtgggcaccggcccctggcacttccactggccagcctgctgggagcaggaa
ctgaggattcacctgcaggatgccccccaagagcaactgaaggtgcccctgagggccctg
ccctctggccaggtggtgagactcgtcttccctacctcccaggagcccatgatgagggtg
gagctggaaaacaaagaagggcccagggagctggctgtgcggctgggctgcaagccctgt
gccgaggagcaggccttcctgagcaggaggaagcaggtggtggccaaggccctgaagcag
gccctgcagctggatggagacctgcaggaggacgagatcccagtgatagctgttatggcc
accggtggggggacccgggccatgacttccctgtatgggcagctggctggcctgaaggag
ctgggcctcttggattgcatctcctacatcacaggggcctcgggtgccacctgggctttg
gccaacctctacgaggacccagagtggtctcagaaggacctggtgggacccatcgagtca
ctgaagacccaggtgaccaagagcaagctgggcgtgctggcccccagccagctgtggcgg
taccggcaggagctggccgagcgtgcccgcctgggctacccgacctgcttcaccgacctg
tgggccctggtcagcgaggcactgctgcatgaccagccccacgaccacaaactctcagac
cagcgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaacacc
aaggaaaagggtctgaccacctttgaatttggggagtggtgtgagttctccccctatgag
attggctttcccaagtacggcgccttcatcccctccgagctctttggctctcagttcttc
atggggcgcctgacaaagcagcttcctgagtcccgcatctgcttcctggaaggtatctgg
agcaacctgtacacagccaacctccaggacagcttgtattggtcctccgagcccagccag
ttttgggaccgctgggcacaggatcagatcagcctggacaaggaccaggtcccccttctg
aaggtagaagagcctcccacagtggccggcaggatagctgagtttttcactgaccttctg
acatggcgtccacttgcccagaccacccacaatttcctacgtggcctctctttccacaag
gactactaccagcatcctcacttctctgcctggaaagccaccaaactggatggcttcccc
aaccagctgacccctgcagagccccacctgtgcctgctggatgttggctacctcatcaat
actagctgcccacctctcctgcgccccacacgggatgtggacctcatcctgtcgctggat
tacaacctccacggagccttccagcagctgcagctcctgggccagttctgccaggagcag
ggcatcccgttcccacccatctcgcccagcccggaggaacagtgccagccccaggagtgc
cacctcttcttggaccccgcctgccctgatgcccccgctgtgctgcacttccctctggtc
aatgcctccttccgggagcactcagcccctggagtccggcggacagcggaggagcaggag
gcagggcaagtgaacctctcttcctccgactccccctaccacttctcgaaggtgacctac
agccaggaggacacagacaagctgctccgtctgacgcagtacaacatctgcaacaaccgg
gagcggctgctggaggcccttcgtgaggctgtgcagcggcggaggcagcgccggcccgag
tga

DBGET integrated database retrieval system