KEGG   Sus scrofa (pig): 100153308
Entry
100153308         CDS       T01009                                 

Gene name
TCTN1
Definition
(RefSeq) tectonic-1 isoform X1
  KO
K19382  tectonic-1/3
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100153308 (TCTN1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    100153308 (TCTN1)
SSDB
Motif
Pfam: DUF1619
Other DBs
NCBI-GeneID: 100153308
NCBI-ProteinID: XP_001929471
Ensembl: ENSSSCG00000009826
UniProt: A0A480JQD0 A0A4X1U4H6
Position
14
AA seq 588 aa
MGPRGLPPLLLVFLGCWASVNAQAGATPVVTTEGFNSTEPAPTTLLPTLSPRPPETPRGP
RPSSGPRPTPVTDVAALCVCDLSPAQCDINCCCDPDCSSTDFSVFSACSIPVVTGDSRFC
SQKAAIYSLNFTADPPQRVFKLVDQINPSMFCIHITNYKPALSFINPEVIADESNFDKMM
KTSDGFSLNAESDVSFTTKPDAPNATKYEYGAHLQTSDSFLRFPSPLTSSLCTDNNPAAF
LVNQAVKCTRRINLEQCEEIETLSMAYYSSPKILKVPGSGTKVPITVQSIVIQSLNKTLT
RLEGIDLLKPRHVEAGHNKICINIVLKVKYSLTYTDAGEIIKADLSLLLGAVSSAMVPLQ
QKFDIYFIQQNTKPVPLSGNPGYGLGLPLAAGFQPRKGSGIIQTTNRYGQFTILRSTTEQ
DCLAIEGIRTPVLFGYNMQSGCKLRLTKTITCRLAAQKVKSLLKGQGFPDYVAPFGNSQA
QDVLDWVPIHFITQTSHVKDSCQLPVALAIEVKWTKYGSLLNPQAKIVNVTANLISSSFS
ETHLGNERTILISTAVTFVDVSAPAEAGFRARPTINARLPFNFFFPFV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggggccacggggcctcccgccgctcctgctagtgttcctgggttgctgggcatctgtg
aacgcccaggccggggccacccctgtggtgactacggagggcttcaactctacggagccg
gccccgacgactctcctacccaccttatcacctaggccccctgagactcccaggggcccc
aggccctcctccggccccaggcctaccccggtcacggacgttgctgctctgtgtgtctgt
gacttgtctccagcacagtgtgacatcaactgttgttgtgatcctgattgcagctccacg
gatttcagtgtcttttctgcctgctcaattccagttgtcacgggtgatagtcggttttgt
agtcaaaaagcagccatctattcactgaattttacagcagacccacctcagagagtattt
aaacttgttgatcagatcaatccatctatgttctgcattcatattacaaactataaacct
gcattatcctttattaatccggaagtaattgctgatgaaagcaattttgataaaatgatg
aaaacatctgatggtttttcattgaatgcagaatcagatgtttcttttacaaccaaacca
gatgctccaaatgctacaaaatatgagtatggggcgcacctgcagacttcagattcattt
ttgaggtttccttcaccccttacatcatctctgtgtaccgataataaccctgcagcattt
ctggttaaccaagctgttaagtgtaccagaaggataaatttggaacagtgtgaagaaata
gaaaccctgagcatggcttattacagcagccctaaaattttgaaggtgcctggttcagga
acaaaggtccctatcactgttcagtccattgtcattcagtctctaaataaaacactaacc
cggctggaaggcattgacttattgaagccaagacatgtggaagctggacacaataaaatc
tgcattaacattgttctcaaggtaaagtacagcctcacatatacagatgcaggtgaaata
ataaaagctgatctctctctccttctgggagcagttagcagtgcaatggttccactccag
caaaagtttgacatttattttattcagcaaaatacaaagccagttcctctcagtggaaac
cccggttatggtttggggctcccgctagctgctggatttcagcctcggaaggggtctggg
attattcagaccacaaatagatacggacaatttactatccttcgtagcacaactgagcaa
gactgcttagcaatagagggaatccggaccccagtattatttggttacaacatgcaatct
ggctgtaaactcaggctgaccaaaactatcacatgtcggctggcagcccagaaggtgaag
agcctgctgaagggtcagggcttcccagattacgtggccccatttggaaattcccaggcc
caggatgtgctggactgggtgcccatccacttcatcacccagacatcccatgtgaaggat
tcttgccagctcccagtggctttggctatagaagtgaagtggactaaatatggatcctta
ttgaacccacaggctaaaatagtcaatgtaactgcaaatctaatttcatcttctttttct
gagacccacttaggaaatgaaaggacaattcttatttctactgcggttacttttgtggat
gtatctgcacctgcagaggcaggcttcagagctcggccaaccatcaacgccaggctgccc
tttaatttcttcttcccgtttgtttga

DBGET integrated database retrieval system