KEGG   Sus scrofa (pig): 100153387
Entry
100153387         CDS       T01009                                 

Gene name
SLA-DQA1
Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain precursor
  KO
K06752  MHC class II antigen
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04145  Phagosome
ssc04514  Cell adhesion molecules (CAMs)
ssc04612  Antigen processing and presentation
ssc04640  Hematopoietic cell lineage
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04672  Intestinal immune network for IgA production
ssc04940  Type I diabetes mellitus
ssc05140  Leishmaniasis
ssc05145  Toxoplasmosis
ssc05150  Staphylococcus aureus infection
ssc05152  Tuberculosis
ssc05164  Influenza A
ssc05166  Human T-cell leukemia virus 1 infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05310  Asthma
ssc05320  Autoimmune thyroid disease
ssc05321  Inflammatory bowel disease (IBD)
ssc05322  Systemic lupus erythematosus
ssc05323  Rheumatoid arthritis
ssc05330  Allograft rejection
ssc05332  Graft-versus-host disease
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100153387 (SLA-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100153387 (SLA-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100153387 (SLA-DQA1)
   04612 Antigen processing and presentation
    100153387 (SLA-DQA1)
   04658 Th1 and Th2 cell differentiation
    100153387 (SLA-DQA1)
   04659 Th17 cell differentiation
    100153387 (SLA-DQA1)
   04672 Intestinal immune network for IgA production
    100153387 (SLA-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100153387 (SLA-DQA1)
   05322 Systemic lupus erythematosus
    100153387 (SLA-DQA1)
   05323 Rheumatoid arthritis
    100153387 (SLA-DQA1)
   05320 Autoimmune thyroid disease
    100153387 (SLA-DQA1)
   05321 Inflammatory bowel disease (IBD)
    100153387 (SLA-DQA1)
   05330 Allograft rejection
    100153387 (SLA-DQA1)
   05332 Graft-versus-host disease
    100153387 (SLA-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100153387 (SLA-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100153387 (SLA-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100153387 (SLA-DQA1)
   05152 Tuberculosis
    100153387 (SLA-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100153387 (SLA-DQA1)
   05164 Influenza A
    100153387 (SLA-DQA1)
   05168 Herpes simplex virus 1 infection
    100153387 (SLA-DQA1)
   05169 Epstein-Barr virus infection
    100153387 (SLA-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100153387 (SLA-DQA1)
   05140 Leishmaniasis
    100153387 (SLA-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100153387 (SLA-DQA1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100153387 (SLA-DQA1)
  Exosomal proteins of epithelial cells
   100153387 (SLA-DQA1)
  Exosomal proteins of breast milk
   100153387 (SLA-DQA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Ig_2 I-set Marek_A C2-set_2
Other DBs
NCBI-GeneID: 100153387
NCBI-ProteinID: NP_001107534
Ensembl: ENSSSCG00000001456
Vega: OTTSUSG00000001374
UniProt: Q7YQ90
Position
7
AA seq 254 aa
MVPGRVLMWGALALTTVMSACGGEDIAADHVASYGLNVYQSYGPSGYFTHEFDGDEEFYV
DLEKKETVWRLPLFSEFTSFDPQGALRNIATLKHNLNIVTKRSNNTAAVNQVPEVTVFSK
SPVILGQPNTLICHVDSIFPPVINITWLKNGHSVKGFSETSFLSKNDHSFLKISYLTFLP
SDDDFYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLIVGLVGIVVGTVFIIQ
GLLSGGPSRHQGSL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggtcccaggccgagttctgatgtggggggccctcgccctgaccaccgtgatgagcgcc
tgtggaggtgaagacattgcggccgaccatgttgcctcctatggcttaaatgtctaccag
tcttacggtcccagcggctattttacccatgaatttgatggcgacgaggaattctacgtg
gacctggagaagaaggagactgtctggcggctgcctctgtttagtgaatttacaagtttt
gacccgcagggtgcactgaggaatatagctacgttaaaacataacttgaacatcgtgact
aaacgctccaacaacaccgcggctgtcaatcaggttcctgaggtgactgtgttttccaag
tctccagtgatactgggtcagcccaacaccctcatctgtcatgtggacagcatctttcct
cctgtgatcaacatcacgtggttgaagaacgggcactctgtcaaaggtttttctgagacc
agcttcctctccaaaaatgatcattccttcctcaagatcagttatctcaccttcctccct
tctgatgatgatttttatgactgcaaagtggagcactggggcctggataagccacttctg
aaacactgggaacctgagattccagcccccatgtcagagctgacagagactgtggtctgc
gccctgggattgatcgtgggccttgtgggcatcgtggtgggcactgtcttcatcattcaa
ggcctgctctcaggtggtccctctagacaccaagggtccttgtga

DBGET integrated database retrieval system