KEGG   Sus scrofa (pig): 100153460
Entry
100153460         CDS       T01009                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100153460 (AKAP5)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100153460 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100153460
NCBI-ProteinID: XP_013833739
Ensembl: ENSSSCG00000002268
UniProt: A0A4X1UEK5 F1SA75
Position
7
AA seq 427 aa
METTVSEIQVESKDEKRSAEVSPQDERQEEKASMLCFKRRKKATKARKPKAGSDAPEAAR
KFPPEAGASDQPQPPGGAWVSVKRLITCRKRSDSSKQQKPCKAKVQPESKDADLSKKKAK
SRLKIPCIKFSKGGKRSNHSKIIEDSDCSIKVQEEAESLDIKTPVQLDDQATKTKSTLDI
REDVSQKDGDEVCESNVNKSITSPGEKVISVELELGTGHSAIPTGTLILEKDIETTEEKP
SIHPQQGSPLETSDIEHPLPVVSDVPPLPAVPDQQIVEEARSSILESGPDWKDHESREIV
AEESKPKDTELSQESDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKAKNVPK
QFLISIESEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
TINNLVQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaatacaagtagaaagcaaggatgagaagagatcagcagaa
gttagtcctcaggatgagaggcaggaggaaaaagcatcgatgctttgcttcaagagaagg
aagaaggcaaccaaagcaaggaagcccaaagctggctctgatgctcctgaggcagcaagg
aaatttcccccagaagcgggagcttctgatcagccacagcccccagggggagcctgggtt
tcagtcaaacgccttataacatgcaggaaaagatcagattcttcaaagcagcaaaagccc
tgtaaggctaaagtgcagcctgaaagcaaggatgctgatctttctaagaaaaaggcaaaa
tccagactcaagattccctgcataaaattctcaaaaggggggaaaagaagtaatcattcc
aaaattatagaagactcagactgcagcattaaagtccaggaagaggctgaaagtttggat
ataaaaactccagtccagttggatgaccaggcaacaaaaaccaagtcaactctggatata
agggaagatgtctcacagaaagatggtgatgaggtctgtgaatcaaatgtgaacaagagc
ataacttctcctggagaaaaagtgatttcagtagaacttgagttaggtacagggcattct
gctattccaaccggaacgctaatccttgaaaaagatattgaaacgactgaagaaaaacca
agcattcatcctcagcaagggagcccactggaaacctcagacatagaacatcccctccca
gtggtttctgatgttcctcccttacctgcagtcccagatcaacaaattgtggaagaagcc
agaagcagtatcctagaaagtggaccagattggaaagaccacgaaagtagagagattgta
gctgaggagagtaagccaaaagatactgaattgagccaggaatcagattttcaagaaaat
gagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgctatt
attatcacagacactgaaatcagtgaatttgatgttaagaaagctaaaaatgtccctaag
caattcctaatttcaattgaaagtgagcaagtaggggtttttgctaatgatagtggcttt
gagggtagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctcttgtc
aagaatgctatccagttgtctatagaacagctggttaatgaaatggcctctgatgataat
acaataaacaatcttgtacagtga

DBGET integrated database retrieval system