KEGG   Sus scrofa (pig): 100153669
Entry
100153669         CDS       T01009                                 

Gene name
TMEM38B
Definition
(RefSeq) transmembrane protein 38B
  KO
K24013  trimeric intracellular cation channel
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    100153669 (TMEM38B)
Transporters [BR:ssc02000]
 Other transporters
  Pores ion channels [TC:1]
   100153669 (TMEM38B)
SSDB
Motif
Pfam: TRIC UPF0126
Other DBs
NCBI-GeneID: 100153669
NCBI-ProteinID: NP_001177093
Ensembl: ENSSSCG00000005429
UniProt: A0A286ZVK0 A0A4X1VCW7
Position
1
AA seq 290 aa
MDSPWDELTLAFSRTSMFPFFDIAHYLVSVMALKHQPGAAAMAWKNPLSSWFTAMLHCFG
GGILSCILLAEPPLRFLANNTNILLASSIWYITFFCPYDLVSQGYSFLPVQLLAAGMKEV
TRTWKIVGGVTHANSYYKNGWIVMIAIGWARGAGGSIITNFELLVKGGWKPEADEWLKMS
YPAKVTLLGSVIFTFQQTKHLAISRHNLMFLYTMFLVATKITMMITESAVMPFAPFEDTL
SRMLFGWQQQFSSCEKKSETKSFNGTGSSTSKPIPNASDKVKKKHTKKTE
NT seq 873 nt   +upstreamnt  +downstreamnt
atggactctccgtgggatgagctgacccttgccttttctcgtacttctatgttccccttt
tttgacatcgctcactacctcgtgtcggtgatggcgctgaagcatcagcctggagcagca
gcaatggcatggaagaatcctctctccagctggtttactgctatgctccactgctttggg
ggaggaattttatcttgtatactgcttgcagagcctccactgaggtttcttgcaaacaac
acaaatatattgctggcatcttcaatttggtatattacatttttttgcccttatgaccta
gtttcccagggctactcattcctacctgttcaacttttggctgcgggaatgaaggaagtg
accagaacttggaaaatagtaggtggagtcactcatgctaatagctattacaaaaatggc
tggatagtcatgatagctattggatgggcccgaggtgcaggtggtagcattatcacgaat
tttgagctgttggtaaaaggaggttggaaaccagaagctgatgaatggctgaagatgtcc
taccctgccaaggtaaccctgttggggtctgttatcttcacattccagcaaaccaagcat
ctggcaatatcaaggcataatcttatgtttctctataccatgtttcttgtggccacaaag
ataaccatgatgattacagagtctgctgttatgccttttgctccttttgaggatacgttg
agtcggatgctgtttggctggcagcagcagttttcatcatgtgaaaagaaaagtgaaaca
aaatctttcaatggtactggttcatcgacttcaaaacctatacctaatgcttcagataaa
gttaaaaagaagcatactaagaagactgagtaa

DBGET integrated database retrieval system