KEGG   Sus scrofa (pig): 100153714Help
Entry
100153714         CDS       T01009                                 

Definition
(RefSeq) uncharacterized protein LOC100153714
  KO
K19330  run domain Beclin-1 interacting and cysteine-rich containing protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100153714
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100153714
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100153714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_9 RUN
Motif
Other DBs
NCBI-GeneID: 100153714
NCBI-ProteinID: NP_001231644
Ensembl: ENSSSCG00000011853
UniProt: E5GAJ0 A0A4X1TSE6
Position
13
AA seq 971 aa AA seqDB search
MRPEGAGMELGGCEESLPEESRREHWQLLGNLKTTVEGLVSANSPNVWSKYGGLERLCRD
MQSILYHGLIHDQVCCRQTDYWQFVKDIRWLSPHSALHVEKFINLHESSQSSTDGVSERA
VAELWLQHSLQCHCLSAQLRPLLGDRQYIRKFYTDTAFLLSDAHVTAMLQCLEAVEQNNP
RLLAQIDASMFARKHESPLLVTKSQSLTALPGSTYTPSTSYAQHSYFGSFSSHQQSIPTH
SSERRSTSFSLSGPPRKPQESRGHVSSAEDQTIQAPVLPASALARDSPSTPNEMSSSTLT
SPLEASWVSSQNDSPSDASEGPEYLAIGNLDPRGRTASCQSHNSNAESSSSNLFSSSSSQ
KPDSAASSLGDQEGGGQSQLSGVLRRSSFSEGQTLTVTGGAKKSHTRSHSDTNIASRGAP
ESCSDKSKLRGPLSYSGQSSEVSSPSSLYMEYEGSQYLGSGEGMFRRPSEGQSLISYLSE
QDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEGEEDSDREIQELKQKIRL
RRQEIRTKNLLPVYQETEHGSFRVTSSSSQFSSRDSAQFSDSGSADEVDEFEIEDADIRR
STPSNSKSFISSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKL
LPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRC
AGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMVIPSRVLRKWDFSKYYVSNFSKDLL
IKIWNDPLFNVQDINSALYRKVKLLNQVRLLRIQLYHMKNMFKTCRLAKELLDSFDTVPG
HLTEDLHLYSLNDLTATRKGDLGPRLAELTRAGAAHVERCMLCQAKGFICEFCQNEDDII
FPFELQKCRTCEECKACYHKACFKSGNCPRCERLQARRELLAKQSLESYLSDYEEEPTEA
LAVEATVLETT
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgcggccagagggcgcgggaatggagcttggcggctgcgaggagagcttgccggaggag
agcaggagggagcactggcagttgctgggtaatttgaagactactgtggagggtttagta
tcagccaatagccccaacgtctggtccaagtatggtggcctggaaaggctttgtagggac
atgcagagcatcctctatcatgggctcatccatgaccaggtgtgttgccgccagactgac
tactggcaatttgtgaaagacatccgctggctcagcccccactcagcccttcacgtggaa
aagttcatcaacttgcatgagagcagccagagcagcactgatggcgtgagcgagcgtgcc
gtggcagagctgtggctgcagcatagtttgcagtgccattgtctctcagcccagctccga
cctctactgggggatagacagtatatcagaaaattctacacagatactgctttcctgcta
agcgacgcccatgtcacagccatgctccagtgcctagaagcagtggaacagaacaaccct
cgtctcctggctcagattgatgcatctatgtttgccagaaagcatgagagcccgctgctg
gtgacaaagagccagagcctgacagctctgcctggttcaacatacaccccttcaaccagc
tatgctcagcattcctactttggatccttctctagccaccagcagtctatacccactcac
agctcagaaagaagatctacttccttttcactgtctggccctcctcggaagcctcaagaa
agcagagggcatgtctcatcagcagaggatcaaaccatccaagctcctgtgcttccagca
tctgcattagccagggactccccctcaaccccaaatgagatgagctccagtactctgacc
agccccttagaagcatcctgggtcagcagccagaatgattccccaagtgatgccagtgag
gggcctgagtacttggccattggcaacctggacccccgcggccggactgccagctgtcag
agtcacaacagcaatgctgagagcagcagttccaatttgttctcctccagcagctcccag
aagccagattctgctgcttcctccctaggggaccaagagggaggtgggcagagccagctg
tccggtgtccttcgcaggtctagcttctccgaggggcaaacactcactgtcaccggtggg
gcaaagaagagccatactcgctcccattcagataccaacattgcctccagaggagctcca
gaatcctgcagtgataagtcgaagttgagaggccccttgtcctactctggtcaaagcagt
gaagtcagctctcccagctctctgtacatggagtatgagggcagtcagtacctgggctcg
ggggaaggcatgttcagaagaccatcagaaggacagtccctcatcagctacctctctgag
caagactttggcagctgtgcagaccttgaaaaggagaatgcccacttcagtatctcagag
tctttgattgctgccattgagctgatgaagtgcaacatgatgagccagtgcctagaggag
gaggaaggggaggaggacagtgacagggagatccaggaactgaagcagaagatccgcctt
cgtcgccaggagatccgcaccaagaatctgctccctgtgtaccaggagactgagcacgga
agctttcgcgtcacttccagcagctcccagttcagttcacgtgattcagcacagttctct
gactctggttctgctgatgaagttgatgaatttgaaatcgaagatgcagacatcagaagg
agcaccccctcaaacagcaaatccttcatttcctctcagtccttctcccactgcttcctc
cactctacatctgctgaggcagtggccatggggctcctgaagcaatttgaggggatgcag
ctcccagccgcctcggagctagagtggctcgttccagagcacgacgcccctcagaagctc
ctgcccatccccgactccctgcccatctcgccagatgatgggcagcatgctgacatctac
aagctgcgtattcgtgttcgtggcaacctggagtgggccccaccccggcctcagataatt
tttaatgttcatccagccccaacgaggaagatcgctgtggccaagcagaattaccgctgt
gcaggttgtggcatccggactgatcctgattatatcaagcggctgcggtactgtgagtac
ttgggcaagtacttctgtcagtgctgccacgagaatgcccagatggttatccccagccgg
gttctgcgcaagtgggacttcagcaagtactatgtcagcaatttctccaaggatctgctc
attaagatctggaatgaccctctcttcaatgtgcaggacatcaacagtgctctctatagg
aaggtcaagctgctcaatcaagtccggctgctgcggatccagctgtatcacatgaagaac
atgtttaagacatgccgactggccaaagagcttctggattcctttgacacagttccaggc
cacctgacagaggatctccacctgtactcactgaacgacctgactgcaaccaggaagggg
gacctgggaccccggcttgctgagctcaccagggcgggggctgcccatgtagagcgatgc
atgctctgccaagccaagggcttcatctgtgagttctgtcagaatgaggatgacatcatc
tttccctttgagctccaaaagtgccggacctgtgaagagtgtaaagcgtgttaccataaa
gcttgtttcaagtctggaaactgtccccggtgtgagcggctgcaggcccggcgggagctg
ctagccaagcagagcctggagtcctacctgtcggactacgaggaggaacccaccgaagcc
ctggccgtggaggccactgtcctggagaccacctga

DBGET integrated database retrieval system