KEGG   Sus scrofa (pig): 100154061Help
Entry
100154061         CDS       T01009                                 

Gene name
CMTR1
Definition
(RefSeq) LOW QUALITY PROTEIN: cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100154061 (CMTR1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     100154061 (CMTR1)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     100154061 (CMTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ G-patch WW G-patch_2 mRNA_cap_enzyme DNA_ligase_A_M
Motif
Other DBs
NCBI-GeneID: 100154061
NCBI-ProteinID: XP_001924245
Ensembl: ENSSSCG00000030570
UniProt: A0A481BL07
Position
7
AA seq 835 aa AA seqDB search
MKRRNDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVNHAAKACATSLSGSDSETEGK
QRSSGSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGFKEGEGLGKYSQGRKDIVEAS
NQKGRRGLGLTLQGFDQELNVDWRAEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKR
KMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKM
ANMDFVFDRMFTNPRDSYGKPLVKNREAELLYFADVCAGPGGFSEYVLWRKKWHAKGXGM
TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENITAFRNFVLDNTDRKGVHF
LMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFICKTFDLFTPFSVGLIYLL
YCCFERVCLFKPITSRPANSERYVVCKGLKVGTDDVRDYLFSVNIKLNQLRNSESDVNLV
VPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWG
IPDQARVAPSSTDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVLDYRCMVSGSEQ
KFLIGLGKSQIYTWDGRQSDRWVKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHI
LDVLVLNGSDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLE
MKIIKGSGGTPKLSYTGRDDRHFVPTGLYIVRTVNEPWTMAFSKSFKRKFFYNKKTKDST
FDLPAEAIAPFHICYFGRLFWEWGDGIRVHDSQKPQDPDKLSKEDVLSFIQTHSA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggagaaatgatccagaatgcactgcccctatcaagaaacagaagaaaagagtt
gcagagcttgctctgagcctcagctctacgtctgatgatgaacctccctcctcagtcaat
catgcggcaaaagcatgcgctacaagcctaagtgggtctgacagcgagaccgaagggaag
cagcgcagctctggttcttttgatgatgcgttcaaagcagactctcttgtggagggaact
tcttctcgctattccatgtataatagtgtttcccagaagcttatggccaagatgggcttc
aaggaaggtgaaggattgggtaaatacagccagggtcggaaggacattgttgaagcttct
aatcagaaaggtcgacgaggcttgggtcttacactgcaaggctttgaccaggagctgaat
gtggactggcgagctgagccagagcccagcgcctgtgagcaggtatcatggttcccagaa
tgtaccactgaaattccagacactcaggaaatgagcgactggatggttgtgggaaagaga
aagatgattattgaagatgaaacagagttttgtggggaagagctgcttcacagtgtgttg
cagtgtaagagtgtgtttgacgtcctggatggggaggagatgcggcgagctcggacccgg
gccaatccctacgagatgatccgaggagtcttcttcctaaacagggcggcaatgaagatg
gctaacatggattttgtgtttgatcgcatgtttacaaacccgagggactcttatgggaaa
ccactagtgaagaaccgggaagctgagcttctctactttgctgacgtgtgtgcaggccca
gggggcttctcggagtacgtgctctggaggaagaagtggcacgcaaagggcnttgggatg
actctgaaggggcctaatgactttaagctggaagacttctactcagcttccagtgagctc
tttgaaccctactatggtgagggtgggatcgacggagatggagacatcacccgcccggag
aacatcactgcttttcggaattttgtcttggataacacagatcgcaaaggtgtccacttt
ctgatggctgatgggggtttctcagtggaagggcaggagaacctgcaggagatcctcagc
aagcagctgctactctgtcaattcctcatggcactctctgttgttcggacaggaggccac
ttcatctgtaaaacctttgacctcttcacaccgttcagcgtggggcttatctacctgctg
tactgctgctttgaacgagtgtgtctctttaagccgattaccagtcgtcctgccaactca
gagaggtatgtggtgtgcaagggcctgaaggtgggcacagatgacgtacgggattacctc
ttctcagtcaatattaagctcaaccagctgcggaactccgagtctgatgtcaaccttgtg
gtccccttggaggtgatcaagggagatcatgaatttaccgattacatgatacggtccaat
gagagccattgtagtctgcagatcaaagctctggccaaaatccatgcctttgttcaagac
acgaccctgagtgagcctcggcaggcagagatccggaaagagtgccttcgactttggggg
atccctgaccaggctcgagttgctccttcttccacagaccccaaatctaaattcttcgag
ctaatccagggcactgagatcgacatcttcagctataagcccacactgcttacttccaaa
accctggagaagatccgccccgtgcttgactaccgctgcatggtgtctggcagtgagcag
aagttcctcatcggcctcgggaagtctcagatctacacgtgggatggccgccagtcagac
cgctgggtcaagctggacctgaagactgagctgccccgggacactctgctctctgtggag
attgtccatgagctgaaaggggaggggaaggcccagcggaagattagtgccatccacatc
ctcgatgtcctcgtactgaatggcagcgacgtgcgggagcagcactttaaccagcgaatt
cagcttgcggagaaatttgtgaaagctgtttccaagcccagtcggcctgacatgaacccc
atcagggtgaaggaggtgtacaggctggaggagatggagaagatttttgtcaggttagaa
atgaagatcatcaagggctccggcggcaccccgaagctcagctacacggggcgggacgac
cggcactttgtgcccacgggcctctacatcgtcaggacagtgaatgagccatggactatg
gcattcagcaaaagcttcaagaggaagttcttctacaacaagaaaaccaaggactctact
tttgacctccctgcagaggccattgctccatttcacatctgctactttggccggctcttc
tgggagtggggggatggcatccgtgtgcacgactcccagaagccccaggacccagacaag
ctgtccaaggaggatgtcctctccttcatccagacacacagcgcctga

DBGET integrated database retrieval system