KEGG   Sus scrofa (pig): 100154071
Entry
100154071         CDS       T01009                                 

Definition
(RefSeq) histone H2A type 1-like
  KO
K11251  histone H2A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04217  Necroptosis
ssc04613  Neutrophil extracellular trap formation
ssc05034  Alcoholism
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100154071
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100154071
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100154071
  09165 Substance dependence
   05034 Alcoholism
    100154071
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100154071
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100154071
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100154071
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100154071
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 100154071
NCBI-ProteinID: XP_013832957
Ensembl: ENSSSCG00000030071
UniProt: F1RPL1
Position
7
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKPKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgaggcaagcagggcggcaaagcccgcgcaaaggccaagacccgctcctcg
cgggccgggcttcagttcccggtgggccgagtgcaccgcctgctccgcaaaggcaattat
gccgagcgggtcggcgccggcgcgcccgtgtacctggcggcggtgctggagtacctgacg
gccgagatcctggagctggctgggaacgcggcccgcgataacaagaagacgcgcatcatt
ccgcgccacttgcagcttgccatccgtaatgatgaagagctcaacaagctactgggcaaa
gtcaccatcgctcagggcggcgtcctgcccaacattcaggctgtgctgctgccaaagaag
actgagagtcaccacaagcccaagggcaaatag

DBGET integrated database retrieval system