KEGG   Sus scrofa (pig): 100154193Help
Entry
100154193         CDS       T01009                                 

Gene name
GBF1
Definition
(RefSeq) LOW QUALITY PROTEIN: Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100154193 (GBF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100154193 (GBF1)
Membrane trafficking [BR:ssc04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100154193 (GBF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DUF758 DUF1045
Motif
Other DBs
NCBI-GeneID: 100154193
NCBI-ProteinID: XP_003483597
Ensembl: ENSSSCG00000010579
UniProt: A0A480X8U4
Position
14
AA seq 1861 aa AA seqDB search
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFSHLKEVLNNVTELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMRAGGMSDSSKWKKQKRSPXPPRHM
TKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQT
TSKEDLTDLEQPGSPGYSTVAEPGSSELGVPEQPDPQEGTHVEKTQSASVESIPEVLEEC
TSPTDHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSVERLNLYAASLRVC
FLLFESMREHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWHIPSFVTELYI
NYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNNL
TQQEKKEAARPGFEAVDGTREANNTERAASDGKAIGMAPDITGLHLPGGGRLPAELGKSG
CSDLEEAGDSGADKKFTRKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQF
LQEKGLLTIPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDE
ALRLYLEAFRLPGEAPVIQRLLEAFTEHWRNCNGSPFANSDACFALAYAVIMLNTDQHNH
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVW
NVLLHRGATPEGIFLRVPAGSYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRK
CAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHG
DILREGWKNIMEAMLQLFRAQLLPKAMVEVEDFVDPNGKISLQREETPSNRGESTVLSFV
SWLTLSGTEQSSVRGPSTENQEAKRMALDCIKQCDPEKMITESKFLQLESLQELMKALVS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAV
VGLLRLXIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG
DDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQSDSELPSYHPNDVSLDRGYTSDS
EVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDIDNSKPGPGPSRPGPSPLVNQYSLTVG
LDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGK
SHKYDSKGNRFKKKSKEGSMLRRPRTSSQHTTRGGHSDDDEDEGVPASYHTVSLQVSQDL
LDLMHTLHTRAASIYSSWAEEQRHLETGGRKIEADSRTLWAHCWCPLLQGIACLCCDARR
QVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMR
ASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVM
DTAEIFHSADARGGSPSALWEITWERIDCFLPHLRDELFKQTVIPDPVPMEPHAPKPLAS
AHLTPAAGDTRTPGHPPPPEMPSELGTCDFEKPEGPRPANSSSPGSPVVSSPSRLSPTPD
GPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPMPTSEV
N
NT seq 5586 nt NT seq  +upstreamnt  +downstreamnt
atggtggataaaaatatttacatcattcaaggggaaattaacattgtggttggggccatc
aaacgaaatgcccgatggagcacccatactccactggatgaagaacgagatcctctactg
catagtttcagtcatctaaaggaggttttaaacaatgtaacagaactctcagaaattgag
cccaatgtattccttcgtccatttctggaagtaattcgctctgaagataccactggccct
atcactggactggcgctcacctctgtcaacaagttcctgtcctatgcactcatagatccc
agccatgagggcacagcagagggcatggagaacatggcagatgctgtcacccatgcccgt
tttgtgggcacagatcctgccagcgatgaggttgtcctgatgaaaatccttcaggtgctg
cggactctgttgctgaccccagtgggtgcccacctaaccaatgaatctgtctgtgagatt
atgcagtcttgcttccggatctgctttgaaatgaggctcagtgagttattgagaaaatcc
gcagagcacactctcgtagacatggtgcagctgctcttcacaaggttacctcagtttaaa
gaagaacccaagaactatgtggggaccaacatgaagaagctgaaaatgagagcaggaggc
atgagtgattcatccaagtggaagaaacagaagaggtcccccncgcccccacgccatatg
accaaagtcacaccaggttcagagctgcccacccccaatggaaccaccttatcctctaac
ctcacgggtggcatgcccttcattgatgtacccactcccatctcctctgcaagttcagaa
gctgcctcagctgtggtcagcccctctacagacagtggcctggagttctcttcccagacc
acctccaaagaggacctcactgacctggagcaacctggctctccagggtacagcacagtt
gcagagcctggcagcagtgagctgggggttcctgagcaacctgacccccaggagggaacc
catgtggaaaagacccaatcagcttctgtggaatccatccctgaagtgttagaagagtgc
acatcccctactgaccactctgactccgcctctgtccatgacatggattacgtcaatccc
cggggcgtgcgctttacacagtcctctcagaaagaaggcacagctttggtcccctatggt
cttccctgcatccgtgagctcttccgcttcctcatctcccttaccaacccacatgaccgc
cacaattcagaggttatgatccacatgggactgcatttgctgacagtggctcttgagtca
gcccctgtagcccagtgccaaaccctcttgggcctcatcaaggatgagatgtgccgccac
ttattccagctactcagcgtagagcgactgaacctttatgctgcttccctacgagtatgc
ttcctactgtttgagagcatgagagagcacctcaagttccagttggagatgtacatcaaa
aagctcatggagatcatcactgtggagaaccccaagatgccttatgagatgaaagagatg
gcactggaggccatcgtgcagctctggcacatccccagctttgtcactgagctctacatc
aactatgattgtgactactactgttccaacctctttgaagagctcaccaagctgctgtcc
aagaatgccttccctgtgtctggtcagctctatacaacacatctgctatctcttgatgcc
ctgttgacagtgattgacagcactgaggcccactgccaggccaaagtcctcaacaacctt
acccagcaggagaagaaagaggcagccagacctggcttcgaggcagtagatggcactcga
gaagccaacaatacggagagagcagccagcgatgggaaggctataggcatggccccagac
atcacaggtctgcatctgccaggtggagggcggctgccagcagaacttgggaaatcagga
tgcagtgatctggaggaagctggtgactctggagctgacaaaaagtttacccggaagcca
cctcgattttcctgtctcctgccagatccacgggaattgattgaaattaagaacaaaaag
aagctgctgatcactggcacagagcagttcaaccagaaaccaaagaaggggatccagttt
cttcaggagaaaggcctcctcaccatcccgatggacaacgcagaggtagcccagtggctg
cgagagaaccctcggctggacaagaaaatgattggagagtttgtgagtgacagaaaaaac
attgacctgttggagagctttgtgagcaccttcagctttcagggtctgcggctggacgaa
gctctccgtctctacctggaagccttccgcttgcctggagaagcaccagtcatccagagg
ttgttagaggcattcacagaacattggaggaattgtaatggctccccatttgccaatagc
gatgcctgctttgccctggcctatgctgtcatcatgcttaatactgaccagcacaaccac
aacgttcgcaaacagaatgcgcccatgaccctagaggagtttcgcaaaaacctaaaaggt
gtgaatggaggcaaggactttgagcaagacatcctggaggacatgtaccatgccatcaag
aatgaggaaattgtgatgcctgaggagcagacaggcttggttcgggagaattatgtatgg
aatgtgctgcttcatcgaggtgccaccccagaaggcatattcctacgtgtacctgctggc
agctatgatcttgacctcttcaccatgacctggggccccactattgctgctctttcttat
gtctttgacaaaagccttgaggagacaatcatccagaaagccatctcaggcttcaggaag
tgtgccatgatctccgcccactatggcctcagcgatgtgtttgacaatctcatcatctct
ctatgcaaattcacagctctcagcagtgagtctattgagaatctgcccagtgtgtttgga
agcaaccctaaagctcacattgcagccaagacagtattccatttggcccatcgtcatggt
gacatcctgcgggagggctggaagaatatcatggaggccatgctacagctcttccgagcg
caactactgcccaaggctatggtggaggtagaagattttgtggatcccaatggcaagatc
tctctacagcgggaggagacaccatcaaaccgaggagaatcgacagtactgagctttgtg
agctggctgacactgagtggtactgagcagtctagcgtgaggggcccatccactgagaac
caagaggccaagagaatggctttggactgtatcaagcaatgtgacccagaaaaaatgatc
acagaaagcaaattcctccagctggagtcactgcaggagctcatgaaggctctggtctca
gtgacgccagatgaagagacatatgatgaggaggatgctgctttctgcctggaaatgctg
ctgaggattgtgctggagaacagggaccgtgtgggctgtgtgtggcagactgttcgagac
cacctataccacctgtgtgtccaagcacaggacttctgcttcctggtggagcgggcagtg
gtggggctgctgcgcctangcattcggctactccggagagaagaaatcagtggccaggta
ctgctttccctgcgcattttgctgctaatgaagcccagcgtgctgtctcgagtcagtcac
caggtagcctatgggcttcacgaactccttaagaccaacgctgccaacatccactcaggt
gatgactgggccaccctcttcacgctgctggagtgcattggctcaggtgtaaagcctcca
gctgccctgcaggccacagccagggccgatgcacctgatgctggggcccagtcagacagt
gaactcccatcctaccatccaaatgatgtgagcctggaccgagggtacacttctgactca
gaggtctacacggaccacggcaggcctggcaagattcatcgatctgccactgatgctgat
gtggtcaacagtggttggttagtggtggggaaggatgacatcgacaactccaagccaggg
cctgggcccagccggccaggcccttcacccctggtcaatcagtacagcctaacagtgggg
ctggaccttgggccacacgatactaagtccctgctcaagtgtgtggagtcactgtcgttc
atcgtgcgtgacgctgcccacatcacacctgacaactttgagctctgtgtcaagactctc
cgcatctttgtggaagccagtctgaatggagggtgcaagtcccaggagaaacgtggcaag
agtcacaaatacgacagcaaagggaaccgcttcaagaagaaatccaaggaaggctccatg
cttcggcggcctcggacctccagtcaacataccactcggggcggacatagtgacgacgat
gaggatgaaggcgtgcctgccagctaccacacggtgtctttacaggtcagtcaggacctg
ctagacctgatgcacaccctgcacacaagggcggcctctatctacagctcctgggcggag
gagcagcgccacctggagacaggaggccggaagattgaagcggactcccgcaccctctgg
gcccactgctggtgccctttactgcagggtattgcctgcctgtgctgtgacgcccggcgc
caggtacggatgcaggcactgacctatctgcaacgagcactgctggtacatgatctgcaa
aaattagatgccctggaatgggagtcctgttttaacaaggtgctgtttcctctattgacc
aagctcttggagaacatcagccctgcagatgtgggcgggatggaggagacccggatgagg
gcttccacactgctctcgaaggtcttcctgcagcacctgtctccactgctgtcactctcc
accttcgcggccctctggctgaccatcctggacttcatggacaagtacatgcacgcaggc
tccagtgacttactgtcagaggccatcccagagtctctgaagaacatgctcctggtgatg
gacacggcggagattttccacagtgcagacgcccgaggaggcagcccctcagcactctgg
gagatcacctgggagcgcatcgactgtttcctgccccacctgcgagatgagctcttcaag
cagactgtcatcccggaccccgtgcccatggagcctcatgcccccaaacctctggcctca
gcccacctgactcctgctgctggggacaccaggacacctggccatccacctcccccagag
atgccttctgaactggggacctgtgactttgagaagccggagggcccccgacctgccaac
agcagctctcctgggtcaccagtggtgtccagccccagcaggctgagtcctaccccagat
gggcctccacctctggctcagcccccactgatcttgcagcccttggcctccccactgcag
gtgggcgtgccccccatgactctgcccatcatcctcaaccccgctctcatcgaggccacc
tcaccagtgcccctcctggccacaccccgccccacagaccccatgcctacctctgaggtc
aactaa

DBGET integrated database retrieval system