KEGG   Sus scrofa (pig): 100154394Help
Entry
100154394         CDS       T01009                                 

Gene name
ROMO1
Definition
(RefSeq) reactive oxygen species modulator 1
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Romo1 Tim17 TCRP1
Motif
Other DBs
NCBI-GeneID: 100154394
NCBI-ProteinID: NP_001090931
Ensembl: ENSSSCG00000007308
UniProt: A0A4X1TBQ2 F2Z5I3
Position
17
AA seq 79 aa AA seqDB search
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtggccgtggggccttacggacagtcccagccaagctgctttgaccgcgtgaag
atgggctttgtgatgggttgcgccgtgggcatggcggcaggggcgctcttcggcaccttt
tcctgtctcaggatcggaatgcggggtcgggagctgatgggcggcatcgggaaaaccatg
atgcagagtggcggcacctttggcacattcatggccatcgggatgggcatccgatgctaa

DBGET integrated database retrieval system