KEGG   Sus scrofa (pig): 100154486
Entry
100154486         CDS       T01009                                 

Gene name
TSPAN14
Definition
(RefSeq) tetraspanin-14
  KO
K17296  tetraspanin-14
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100154486 (TSPAN14)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100154486 (TSPAN14)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100154486
NCBI-ProteinID: XP_001926637
Ensembl: ENSSSCG00000010341
UniProt: A0A4X1SH99 A0A481B903
Position
14
AA seq 270 aa
MHYYRYSNAEVSCWYKYLLFSYNIVFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGID
PVVLVLMVGVVMFTLGFAGCVGALRENICLLNFFCSAIVLIFFLELAVAVLAFLFQDWVR
DRFREFFESNIRSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC
GVPFSCCVPDPAQKVVNTQCGYDVRTQLKSKWDESIFTKGCIQALEGWLPRNIYIVAGVF
IAISLLQIFGIFLARTLISDIEAVKAGHHF
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcactattatagatactctaacgccgaggtcagctgctggtacaagtacctccttttc
agctacaacatcgtcttctggttggctggagttgtcttcctcggagttggactatgggca
tggagcgaaaagggggtgctgtccgacctcaccaaagtgacccggatgcatgggattgac
cctgtggtgctggtcctgatggtgggcgtggtgatgttcacactgggctttgctggctgc
gtgggggcccttcgggagaacatctgcctgctcaactttttctgcagtgccattgtgctc
atcttctttctggagctggctgtggccgtgctggccttcctcttccaggactgggtaagg
gaccggttccgggaattcttcgagagcaacatccgatcctaccgggatgacatagacctg
cagaacctcatcgactcccttcagaaagctaaccagtgctgcggggcatacggccctgaa
gactgggacctcaatgtctatttcaactgcagtggtgccagctacagccgcgagaagtgt
ggggtgcctttctcctgctgcgtgccagaccccgcgcaaaaagttgtgaacacacagtgt
ggctatgatgtcaggactcagctgaagagcaaatgggacgagtccatcttcacaaaaggc
tgcatccaggcgctggagggctggctcccccggaacatctacattgtggccggtgtcttc
atcgccatctcactgctgcagatatttggcatcttcctggcgagaaccctgatctctgac
attgaagcggtgaaggcaggtcaccacttctga

DBGET integrated database retrieval system