KEGG   Sus scrofa (pig): 100154640Help
Entry
100154640         CDS       T01009                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04020  Calcium signaling pathway
ssc04713  Circadian entrainment
ssc04925  Aldosterone synthesis and secretion
ssc04927  Cortisol synthesis and secretion
ssc04929  GnRH secretion
ssc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100154640 (CACNA1I)
   04020 Calcium signaling pathway
    100154640 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100154640 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    100154640 (CACNA1I)
   04927 Cortisol synthesis and secretion
    100154640 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100154640 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100154640 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100154640 (CACNA1I)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100154640 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 100154640
NCBI-ProteinID: XP_020948761
Position
5
AA seq 2283 aa AA seqDB search
MAASRPIATLERMIFCPGVDTWRAEVPGNLRKRHGCFSGTKSKALSSGENPASLTSREKW
QEAPTPACCPLEPEECPNVSVLGSSADSLAATGSSWLSPPPSPAAAPAAEPGVTEQPGPQ
SPPPSPPGXEQPLDGGDPEVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFECVSMLVI
LLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFVFFAMEMVLKMVALGIFGKKCYLGDT
WNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPML
GNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLDENFTIQGDVALPPYYQPEEDDEMPFIC
SLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTG
SANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFM
INLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKA
KRRALGLYQALQSRRQAPGQEAPGSAKPGPHAKEPRHYKLCPRHSPLDPTPHTLVQPISA
MLASDPASCPRCQREAGRRPSGPGSSDSGQEGSGSGGSAGGEADGDGARSSEDAASSELG
KEDEEEQADGAAGLCGDLWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHQQPEE
LTNILEICNVVFTSMFALEMLLKLAAFGLFDYLHNPYNIFDSVIVIISIWEIVGQADGGL
SVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCK
FSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMT
FGNYVLFNLLVAILVEGFQAEGDANRSYSEEDQSSSNIEEFDKLHEGLDSSGDPKLCPIP
MTPNGHLDPNLPLGGRLGPVGSAASAPRLSLQPDPMLMALGSRKSSVMSLGRMSYDQRSL
SSSRSSYYGPWGRSGAWASRRSSWNSLKHKPQSAEHESLLSQERGGGGGARASEGARDDG
PPRAAPLHAPHAHHAHHGPHPVHRHRHHRRTLSLDTRDSVDLAELVPAVGTHPRAAWRAA
GPTPGHEDCNGRMPSIAKDVFTKMDDRRDRGEDEEEIDYTLCFRVRKMIDVYKPDWCEVR
EDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLT
VSNYIFTAIFVGEMTLKIVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLASAGGA
KILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGV
QLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNI
MYNGLDAVAVDQQPVPNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEE
ARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMS
LEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMG
ITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLL
FMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMK
DTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAE
MDAELELEMAHSLGPSPRPPASSPGAPVPGQGPGGAGGGGDAEGRLCRRCYSPAQENLWL
DSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCEKCHHDKQEVQLAETEAFSLNSDRS
SSILLGDDLSLEDPTACPLGPRDSKGEPDPPEPMRVGDLGECFFPVSSTAVSSGPENFLC
EMEAIPFNPVRSWLKHESSQAAPPSPFSSDASSPLLPMPAEFFHPAVAASQKGQERAAGA
GTLPKIALQGSWASLRSPSVNCTLLRQATGSDTSLEASRSSSGGSLQTTLEDSLTLSDSP
RRALGPPAPALGPRAGPSPATRRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTQHDS
MDPSDEEGAGGRAGGGGGGAGSEHSETLSSLSLTSLFAPPPPPPGLPPARRFSSTSSLAA
GPGRPRTAARPRGLARSPSWAADRRKDPPGQAEPAAGRGPSAPEPQPPPREPQPGDAASR
GRR
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgagcagacccatagccaccctggagagaatgattttctgcccaggggttgac
acgtggcgggccgaggtgcctggaaacttacgtaagcgccatggctgtttttctggaacc
aagagcaaagccctgagctcgggagaaaaccctgcctcgctgaccagccgggagaagtgg
caggaggcgccaactcccgcctgttgccccctggagccagaggaatgtccaaatgtatca
gttctgggcagttcagctgacagcttagcggccacgggcagcagctggctctcgccgccc
ccgtcccctgccgcagccccagcagctgagccaggagtcacggagcagccggggccccag
agcccccctccctcccctccaggcnccgagcagcccctggatggaggcgatccagaggtc
cctcacccggacctggcaccggttgccttcttctgcctgcgacagaccaccagcccccgg
aactggtgcatcaagatggtgtgtaacccgtggtttgaatgtgtcagcatgctggtgatc
ctgctgaactgcgtgacccttggcatgtaccagccctgcgacgatatggactgtctgtca
gaccgctgcaagatcctgcaggtctttgatgacttcatctttgtcttctttgccatggag
atggtgctcaagatggtggccctgggcatttttggcaagaagtgctacctcggggacaca
tggaaccggctggatttcttcattgtcatggcggggatggtcgagtactccctggacctt
cagaacatcaacctgtctgccatccgcaccgtgcgtgttctgaggcccctcaaagccatc
aaccgtgtgcccagtatgcggatcctggtgaacctgctcctggacacgctgcccatgctg
gggaatgtcctcctgctctgcttctttgttttcttcatctttggcatcattggcgtgcag
ctctgggcgggcctgctgcgcaaccgctgcttcctggacgagaacttcaccatacaaggg
gatgtggccctgcccccctactaccagccagaagaggatgacgagatgcccttcatctgc
tccctgtccggtgacaacggcatcatgggctgtcacgagatcccccctctcaaggagcag
ggccgcgagtgctgcctgtccaaggatgacgtctatgactttggggcggggcgccaggat
cttaatgccagcgggctctgcgtcaactggaaccgctactacaacgtgtgccgcacgggc
agcgccaacccccacaagggcgccatcaactttgacaatatcggctacgcctggatcgtc
atcttccaggtgatcactctggaaggctgggtggagatcatgtactacgtgatggatgcg
cactccttctacaacttcatctacttcatcctgctcatcatagtgggctccttcttcatg
atcaacctgtgcctcgttgtcatagcgacccagttctcggagaccaagcagcgggagcac
cggctgatgctggagcagcggcagcgttacctgtcctccagcacggtggccagctacgcc
gagcccggcgactgctacgaggagatcttccagtacgtctgccacatcctgcgcaaggcc
aagcgccgggccctgggcctctatcaggctctgcagagccggcgccaggccccgggccag
gaggcacccggctctgccaagcccgggccccacgccaaggagcctaggcactacaagctg
tgcccccgacacagcccgctggacccgacgccgcacacgctggtgcagcccatctctgcc
atgctggcctccgaccccgccagctgcccccgctgccagcgcgaggccggccggcggcct
tcgggcccgggcagcagtgactcgggccaggagggctcgggctccgggggctcggctggt
ggtgaggccgatggggatggggcccgaagcagtgaggacgcggcctcctcggagctgggg
aaggaggacgaggaggagcaggcggacggggctgccgggctgtgcggagacctgtggcgg
gagacgcgggccaagctgcggggcatcgtggacagcaagtacttcaaccggggcatcatg
atggccatcctggtcaacaccgtcagcatgggcatcgagcatcaccagcagcccgaggag
ctgaccaacatcctggagatctgcaatgtcgtcttcaccagcatgtttgccctggagatg
ctgctgaagctggctgccttcgggctctttgactacctgcacaacccctacaacatcttc
gacagcgtcattgtcatcatcagcatttgggagatcgtggggcaggcagacggcggtctg
tcggtgctgcggaccttccggctgctgcgggtgctgaagctggtgcgcttcatgcccgcg
ctgcggcgccagctcgtggtgctcatgaagaccatggacaacgtggccaccttctgcatg
ctgctcatgctcttcatcttcatcttcagcatccttgggatgcacatctttggctgcaaa
ttcagcctccgcacagacacgggagacacggtccccgaccggaagaactttgactccctg
ctgtgggccatcgtcaccgtgttccagatcctcacccaggaggactggaacgtcgtcctc
tacaacggcatggcctccacctccccgtgggcctccctctacttcgttgccctcatgacc
ttcggcaactacgtgctcttcaacctgctggtggccatcctggtggagggcttccaggcg
gagggcgacgccaatcgctcctactctgaagaggaccagagctcatccaacatagaggag
tttgacaagctccacgagggcctggacagcagcggagatcccaagctctgcccaatcccc
atgacccccaatgggcacctggacccaaatctccccctgggtggacgtctgggccccgtt
gggtctgcagcatccgccccccgcctctcgctgcagccagaccccatgctaatggccctg
ggctcccgcaagagcagtgtcatgtctctagggaggatgagctacgaccagcgctccctg
tccagctctcggagctcctactatgggccgtggggccgcagcggggcctgggccagccgc
cgctccagctggaacagcctcaagcacaagccgcagtcggcagaacacgagtccctgctc
tcgcaagagcgcggcggcggcggcggcgcccgggcctccgagggtgcccgggacgacgga
ccgccgcgggccgcgcccctgcacgccccgcacgcccaccacgcgcatcatggtccccac
ccggtgcaccgtcaccgccaccaccgccggacgctgtccctcgacaccagagactcagtg
gatctggccgagctggtgcccgccgtgggcacccacccccgggcagcttggagggcggcg
ggcccgactccgggccatgaggactgcaatggcaggatgcccagcatcgccaaggatgtc
tttacgaagatggacgaccgccgggaccgcggggaggacgaggaggagatcgactacact
ctgtgcttccgcgtccgcaagatgattgacgtgtacaaacccgactggtgtgaagtccga
gaggactggtctgtctacctcttctcacctgagaacaggttccgggtcctgtgtcagacc
atcatcgcccacaagctcttcgactatgtcgtcctggccttcatcttcctcaactgcatc
accatcgccctggaacggccccagattgaggccggcagcaccgaacgcatcttcctcact
gtgtccaactacatcttcacagccatcttcgtgggcgagatgacgctgaagatagtctcg
ctggggctgtacttcggggagcaggcgtacttgcgcagcagctggaatgtgctggatggc
ttcctcgtcttcgtgtccatcatcgacatcgtggtgtccctggcctccgcggggggagcc
aagatcctgggagttctccgggtcctgcggcttctgcgcaccctacggcccttgcgtgtc
atcagccgggcgcccggcctgaagctggtggtggagacactcatctcctccctgaagccc
atcggcaacattgtcctcatctgctgtgcgtttttcatcatcttcggcatcctgggggtg
cagctcttcaagggcaagttctaccactgtctcggtgtagacacccgcaacatcaccaac
cgctccgactgcgtggccgccaactaccgctgggtccatcacaagtacaacttcgacaat
ctgggccaggccctgatgtccctcttcgtgctggcttccaaggacggctgggtgaacatc
atgtacaacggactggacgctgtcgctgtggaccagcagcccgtgcccaaccacaacccc
tggatgctgctctacttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatg
tttgtgggcgtcgtggtggagaatttccacaagtgccggcagcaccaggaggccgaggag
gcgcggcggcgcgaggagaagcggcttcggcgcctggagaagaagcgccggaaggcccag
cggctaccctactatgccacctactgtcccactcggctgctcatccactccatgtgcacc
agccactacctggacatcttcatcaccttcatcatctgcctcaatgtggtcaccatgtcc
ctggagcactacaatcagcccacgtctctggagacagccctcaagtattgcaactacatg
ttcaccactgtctttgtgctggaggctgtgctgaagctggtggcttttggtctgaggcgc
ttcttcaaggataggtggaaccagctggacctggccatcgtgctgctgtcagtcatgggc
atcacgctggaggagatcgagatcaatgcagcgctgcccatcaaccccaccatcatccgg
atcatgcgggtcctgcgcatcgcccgggtgctgaagctgctgaagatggccacgggcatg
cgggccctgctggacaccgtggtgcaagctctgccccaggtgggcaacctgggcctcctc
ttcatgctgctctttttcatctacgccgccctgggagtggagctctttgggaagctggtc
tgcaatgacgagaacccgtgcgagggcatgagccggcacgccaccttcgagaacttcggc
atggccttcctcacgctcttccaggtctccactggtgacaactggaacgggatcatgaag
gacacgctgcgggactgcacccacgacgagcgcagctgcctgagcagcctgcagttcgtg
tcgccgctgtacttcgtcagcttcgtgctcacggcccagttcgtgctcatcaacgtggtg
gtggccgtgctcatgaagcacctggacgacagcaacaaggaggcccaggaggacgccgag
atggacgccgagctcgagctggagatggcccacagcctgggccccagcccgcggccacct
gccagctccccgggggcgccggtgcccggccaagggccaggaggggcgggcggtgggggt
gacgccgagggccgcctgtgccgacgctgctactcgccagcccaggagaacctgtggctg
gacagcgtctctttaatcatcaaggactctttggagggagagctgaccatcattgacaac
ctgtctggctccatctttcaccactattcctcgccggccggctgcgagaagtgtcaccat
gacaagcaagaggtgcagctggccgagacggaggccttctccctgaactcagacaggtcc
tcgtccatcctgctgggcgatgacctgagtctggaggatcccacggcctgcccgctcggc
cccagagacagcaagggagagccagacccacctgagcccatgcgtgtgggggacctgggc
gaatgcttcttccccgtatccagcacggctgtctcgtcgggtccagaaaacttcctctgc
gagatggaggcgatcccgttcaaccctgtccggtcctggctgaaacatgaaagcagccaa
gcagcacccccgagccccttctcctcggatgcctccagcccactcctgcccatgccggcc
gagttcttccaccccgctgtggctgccagccagaaagggcaggagagggccgctggtgct
gggaccctgccgaagatcgccctgcagggctcctgggcttccctgcggtcgccgagcgtc
aactgtaccctcctccggcaggccaccgggagcgacacgtcgctggaggccagccgcagc
agctcggggggcagcctgcagaccacgctggaggacagcctgaccctgagcgacagcccg
cggcgcgccctggggccccccgcgcccgccctggggccccgcgccggcccgtcgcccgcc
acccgccgccgcctgagcctgcggggccggggcctgttcagcctgcgcgggctgcgggcg
caccagcgcagccacagcagcgggggctccaccagcccgggctgcacgcagcacgactcc
atggacccctcggacgaggagggcgcgggcggccgggccggcgggggcggcgggggcgcg
ggcagcgagcactcggagaccctgagcagcctgtcgctcacctccctcttcgcgccgccg
cccccgccgcccgggctcccgcccgcgcgcaggttcagcagcaccagcagcctggccgcc
ggccccggccgcccgcgcaccgccgcccggccccgcggcctggcgcgcagcccctcctgg
gccgccgatcgccgcaaggacccgccaggccaggccgagccggccgccggccggggcccc
tcggcgcccgagccgcagccgccgccgcgggagccgcagcccggggacgcggcgagccgg
gggaggagatga

DBGET integrated database retrieval system