KEGG   Sus scrofa (pig): 100155082
Entry
100155082         CDS       T01009                                 

Gene name
GON7
Definition
(RefSeq) EKC/KEOPS complex subunit GON7
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: DUF4611
Other DBs
NCBI-GeneID: 100155082
NCBI-ProteinID: NP_001161062
Ensembl: ENSSSCG00000002459
UniProt: P0C8B5
Position
7
AA seq 100 aa
MELLGEYVGQDGQRQRLRVPCEAPGNADHFQGLLSGVARMKELVAELFGSPVQGEAQDRV
AAAPEEALDGDDEDDAEDENNIDNRTNSDGPTAKRPKPPS
NT seq 303 nt   +upstreamnt  +downstreamnt
atggagctgttgggcgagtatgtcgggcaggacgggcagcggcagcggctacgagtgccc
tgtgaggcgccaggcaatgccgaccatttccagggcttgctgtcgggcgtggctcggatg
aaggagctggtggccgagctcttcggttccccggtacagggggaagctcaggaccgggtg
gcggcggctccagaagaggccttggacggtgatgatgaagatgatgcagaagatgaaaat
aacattgataacagaactaactcagatggaccaactgcaaaacggccaaaaccaccatct
taa

DBGET integrated database retrieval system