KEGG   Sus scrofa (pig): 100155100
Entry
100155100         CDS       T01009                                 

Symbol
BNIPL
Name
(RefSeq) bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
  KO
K18448  BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    100155100 (BNIPL)
SSDB
Motif
Pfam: BNIP2 CRAL_TRIO_2 CRAL_TRIO DUF6239
Other DBs
NCBI-GeneID: 100155100
NCBI-ProteinID: XP_001928046
Ensembl: ENSSSCG00000006640
UniProt: F1SSA0 A0A4X1W1S0
Position
4:complement(98184038..98193522)
AA seq 358 aa
MGTLQEAGEKTLDLGVRENAETAVPEASLRLGGLELQEEWQDEEFPRLLPEEADPSEDPE
NPKGDSQTAPGTPSTLALCGQRPMRKRLTAPELQLNLTEGPGDNGASSTHSVPSSPDGSS
DLEVDELETPSDSEQLDSGHEFEWEDDLPRAEDPGASEAAERLGRGCVWDVAGEDGHHWR
VFRTGQREQRVDMTVIEPYKKVLSHGGYHGDGLNAVILFASCYLPRSSIPNYTYVMEHLF
RYMVGTLELLVAENYLLVHLSGGTNRAQVPPLSWLRQCYHTLDGRLRKNLRALVVVHATW
YVKAFLALLRPFISSKFTRKIRFLNSLGELAQLISMDQVHIPEAVRQLDQDLHGSGGT
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggaactctacaagaggcaggagaaaagacattggatcttggggtcagggaaaatgca
gaaacagcggtgccagaagcatccttgagacttggggggctggagctgcaggaagaatgg
caggatgaagaattccctagattgcttcctgaagaggctgacccttctgaagatcctgag
aaccctaaaggagactcacagacggccccaggtacccccagcaccttagccctgtgtggc
cagcgccccatgcgtaagcgtctgactgccccagagttgcagctgaatctgacagaaggg
cctggagataatggagcttcttccacccactctgtaccttcctctcctgatggcagttct
gacctggaggtagacgaattggagacaccttcagactcggagcagctggacagcggacac
gaatttgaatgggaagatgacctgccccgggcagaggatccaggggccagtgaggcagct
gaaaggctgggcagaggttgtgtgtgggatgtggctggagaagatggtcatcactggagg
gtgttccgaacaggacagcgggagcagcgagtggacatgactgtcattgagccctacaag
aaagtcttatctcatggaggctaccatggtgatggcctcaatgctgtcatcctctttgct
tcctgttatttacccagaagcagcatccccaactacacctatgtcatggaacacttgttt
aggtacatggtgggaactctggagctgctggtggctgaaaattatctgcttgttcacttg
agtggaggcacaaatagggcccaagtcccacctctgagctggctacgccaatgttaccat
accctggatgggcggctccggaagaacctgcgcgccctggtggttgtccacgctacatgg
tatgtgaaggcattcctggcactgcttcgacccttcatcagttccaagttcacacgaaag
atccgttttctgaacagccttggagagctggcccaactcatctccatggatcaggtccac
atcccagaagctgtcagacagctggaccaggatctccatggctcaggagggacctag

DBGET integrated database retrieval system