KEGG   Sus scrofa (pig): 100155309Help
Entry
100155309         CDS       T01009                                 

Gene name
IDE
Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100155309 (IDE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100155309 (IDE)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     100155309 (IDE)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M16: pitrilysin family
   100155309 (IDE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 100155309
NCBI-ProteinID: XP_001925416
Ensembl: ENSSSCG00000010470
UniProt: F1SC98 A0A4X1UYL0
Position
14
AA seq 1019 aa AA seqDB search
MRYRLAWLLHPALPSTFRSVLGARLPPLERLCGFQKKTYSKMNNSAIKRLGNHIIKSPED
KREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKK
YPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKD
REVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRPNQEGIDVRQE
LLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLRQ
LYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLV
GGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV
AFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAI
VSKSFEGKTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILSL
EKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELL
KDSLNEYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFE
IIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLL
SRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWFVYQ
QRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA
NGIQGLRFIIQSEKPPHYLESRVEAFLVTMEKSIEDMAEEAFQKHIQALAIRRLDKPKKL
SAECAKYWGEIISQQYNFDRDNIEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLA
REMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgcggtaccggctagcgtggctgctgcaccccgcgctgcccagcaccttccgctccgtc
ctcggcgcacgcctgccgcccctggagcgcctctgtggtttccaaaaaaagacttacagc
aaaatgaataattcagctatcaagaggctgggaaatcatatcatcaaatctcctgaagat
aaacgagaataccgtgggctagagctggccaatgggatcaaagtacttctcatcagtgat
cccaccacagataaatcatcagcagcacttgatgtacacataggttccttgtcagatcct
ccaaatattgctggcttgagtcatttttgtgaacatatgctatttttgggaacaaagaaa
taccctaaggaaaatgaatacagccagtttctcagtgagcatgcaggaagttcaaatgcc
tttactagtggagagcataccaattactattttgatgtttcccatgaacacctagaaggt
gccctagacaggtttgcacagttttttctatgtcccctatttgatgagagttgcaaagac
agagaagtgaatgcagttgattcagaacatgagaagaatgtgatgaatgatgcctggaga
ctctttcagttggaaaaggctacagggaatcccaatcaccccttcagcaaatttggaaca
ggtaataaatatactctagagactagaccaaaccaagaaggcattgatgtaagacaagag
ctgctgaaattccattctacttattattcatccaacttgatggctatttgtgttttgggt
cgagaatctttagacgacttgactaatctggtcgtaaagttattttctgaagtagagaac
aaaaatgtcccattgccagaatttcctgaacatcctttccaagaagaacatcttagacaa
ctttacaaaatagtacccattaaggatattaggaatctttatgtgacatttcccatacct
gaccttcagaaatactacaaatcaaatcctggtcattatcttggtcatctcattgggcat
gaaggccctgggagtctgttatcagaacttaaatcaaagggctgggtaaatactcttgtt
ggtgggcaaaaggaaggagcccgaggttttatgttttttatcattaatgtggacctgact
gaggaaggattgttacatgttgaagatataattttgcacatgtttcaatatattcagaag
ttacgtgcagaaggacctcaagaatgggttttccaagagtgcaaggacttgaatgctgtt
gcttttaggtttaaagacaaagagaggccacgaggttatacctctaagattgcaggaata
ttgcattactatcccctagaagaagtgctcacagctgaatatttactggaagaatttaga
cctgatttaatagagatggttctcgataaactcagaccagaaaatgttcgggttgcaata
gtttctaaatcttttgaaggaaaaactgatcgcacagaagagtggtacggaacccagtac
aaacaagaagctataccagacgaagtcattaagaaatggcaaaatgctgacctgaatggg
aaatttaaacttccaacgaagaatgaatttattcctacaaattttgagattttgtcatta
gaaaaagaagcaacaccatacccttctcttattaaggatacggctatgagcaaactctgg
ttcaaacaagatgataagtttttcttgcccaaggcctgtctcaactttgagtttttcagc
ccatttgcttatgtggaccccttgcactgtaacatggcctatttgtaccttgagctcctc
aaagactcactcaacgagtatgcatatgcagcagagctagcaggcttgagctatgacctc
caaaataccatctatgggatgtatctctcggtgaaaggttacaatgacaagcagccaatt
ttgctaaagaagattattgagaaaatggctacctttgagattgatgaaaaaagatttgaa
attatcaaagaagcatacatgagatcgcttaacaatttccgagctgagcagcctcaccag
cacgccatgtactacctccgcctgctgatgacagaagtggcctggactaaagatgaatta
aaagaagccctggatgatgtcacccttcctcgccttaaggccttcatacctcagctcctg
tcaaggctgcacatcgaagcccttctccatggaaacataacaaagcaggccgcattagga
attatgcagatggttgaagacacccttattgaacatgcccatacgaaaccgctccttcca
agtcagctggttcggtatagagaagttcagctccctgatagaggctggtttgtttatcag
cagaggaatgaagttcacaataactgtggcatcgagatatactaccagacagacatgcag
agcacctccgagaatatgttcctggagctcttctgtcagatcatctccgagccttgcttc
aacaccctgcgcaccaaggagcagctgggctatatcgtcttcagcgggccacgccgagcc
aacggcatccagggcttacggttcatcatccagtcggaaaagccacctcactacctagag
agcagagtggaagctttcttagttaccatggaaaagtccatagaggacatggcagaagag
gcctttcaaaaacacattcaagccctagcaattcgtcgactagacaaaccaaagaaactg
tccgcagagtgtgctaaatactggggggaaatcatctcccagcaatacaactttgacaga
gataatatagaagttgcatatttaaagacacttaccaaggaagatattatcaaattctat
aaggaaatgttggcagtggatgccccgaggagacataaggtgtctgtccatgttcttgct
agagaaatggattcttgtcccgtggttggagagttcccatgtcaaaatgatataaatttg
tcacaagcaccagccttgccgcaacctgaagtgattcagaacatgaccgagttcaagcgt
ggtttgccactgtttccccttgtgaaaccacatattaacttcatggctgcaaaactctga

DBGET integrated database retrieval system