KEGG   Sus scrofa (pig): 100155319
Entry
100155319         CDS       T01009                                 

Gene name
COL9A1
Definition
(RefSeq) collagen alpha-1(IX) chain isoform X1
  KO
K08131  collagen type IX alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc04974  Protein digestion and absorption
ssc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100155319 (COL9A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100155319 (COL9A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100155319 (COL9A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100155319 (COL9A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100155319 (COL9A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ssc00535]
    100155319 (COL9A1)
Proteoglycans [BR:ssc00535]
 Extracellular matrix (ECM) proteoglycans
  Others
   100155319 (COL9A1)
Motif
Pfam: Collagen Laminin_G_2 Laminin_G_3
Other DBs
NCBI-GeneID: 100155319
NCBI-ProteinID: XP_003121321
Ensembl: ENSSSCG00000004274
UniProt: A0A5G2QD63
Position
1
AA seq 922 aa
MTSFWKIPVFFFVCSFLGSWGSTTVKRRPRFPVNSNSNGENELCPKVRIGQDDLPGFDLI
SQFQIDKAASRRAIQRVVGSTALQVAYKLGKNVDFRIPTRQLYPSGLPEEYSFLTTFRMT
GSTLEKNWSIWQIQDSSGKEQVGVKINGQTKSVAFSYKGLDGSLQTAAFSNLPSLFDSQW
HKIMIGVERNSATLFVDCNRIESLPIKPRGQIDVDGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPSRETCHELPARITPSQTIDQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPPGEPGKPGVPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGAPGPRGFPGRGIP
GPPGPPGGAGLPGELGRVGPIGDPGRRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRS
GYPGLPGMRGHKGAKGEVGEPGRQGHKGEEGDQGEPGEVGAQGPPGAQGLRGITGIAGAK
GEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEIGPKGDRGAQGSRGIPGLPGPKGDTGLP
GVDGREGIPGMPGTKGEPGKPGPPGEAGLQGLPGIPGIPGAKGVAGEKGNTGAPGKPGQL
GNSGKPGQQGPPGEVGPRGPRGLPGSRGEIGPVGPPGPPGKLGSLGSPGLPGLPGPPGLP
GMKGDRGVVGEPGPKGEQGVSGEEGEAGERGELGDIGLPGPKGSVGNPGEPGLRGPEGSR
GLPGVEGPRGPPGPRGVQGEQGATGLPGIEGPPGRAPTDQHIKQVCMRVMQEHFAAMAAS
LKRPESGASGLPGRPGPPGPPGPPGENGFPGQMGLRGLPGMKGPPGALGLRGPKGDMGER
GDRGPPGRGPKGLPGATGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGPPGF
CEPASCTMQAGQRAFNSKGPDQ
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgacaagcttctggaaaattccagttttcttcttcgtatgcagtttcctgggatcctgg
ggatccacgactgtcaagcgtcgcccaaggtttcctgtcaattcaaattctaatggtgaa
aatgaactctgtccaaaagtcaggattggacaagacgatttaccagggtttgacttgatt
tctcagttccagatagacaaagcagcatccagaagagctatccagagagtagtgggatca
actgcattgcaagtggcttataaattgggaaaaaatgtagacttcagaattccaactagg
caattgtatcccagtgggctgcctgaagaatactcctttctaaccacttttcggatgact
ggaagcacacttgaaaagaactggagcatttggcagattcaggattcctcagggaaggag
caagttggcgtgaagataaatggccaaacaaaatcagttgcattttcatacaaagggctg
gacgggagtctccaaactgcggccttttcgaatttgccctccttgtttgattcccagtgg
cataagatcatgattggtgtggaaaggaacagcgcaactctttttgttgactgcaacagg
attgagtccttacctataaagccaagaggccaaattgatgttgatggctttgctgtgctc
ggaaaacttgtggacaatcctcaagtttctgttccgtttgaacttcagtggatgctgatt
cattgtgacccactgcgacccagcagagaaacttgccatgagttgccagccaggattaca
cccagccagaccatcgaccagaggggccccccaggtgagcagggtcctcctgggccaccg
ggccctcctggagtccctggcatcgacggtattgacggtgaccgaggtccgaagggtccc
ccaggccccccgggtcccccaggagaaccgggaaagccaggagttcccggcaagcctggc
acgccgggcgccgacggattaacaggacctgatggatcccctggctctgttggaccaaga
ggacaaaaaggagaacctggtgcaccgggacctcgtggattcccaggtcgtggtattcct
ggacctcctggtcctccagggggggcaggacttccgggagagcttggccgtgttggacca
attggcgaccctgggagaagaggaccacctggcccccctggccccccgggacccagcgga
acaattggctttcatgatggagatccattgtgtcccaattcctgcccaccaggtcgctct
ggatatccaggcctgccaggcatgaggggtcataaaggggctaaaggagaggttggtgaa
cctggaagacaaggtcacaagggtgaagaaggggaccagggcgagcctggagaggttgga
gctcaaggacctccgggagctcaaggtttgcgaggcatcaccggcatagctggggccaaa
ggggaaaaaggtgctcggggcttagatggagaacctgggcctcaaggtctccctggtgca
cctggtgatcaaggacagcgaggacctccaggagaaataggtcccaagggagacagaggg
gctcaaggttctcgaggaattcctggtctccctggacccaaaggggacacgggcctgcca
ggtgtggacggccgggaaggaatacctggaatgcctggaacaaagggtgaaccagggaaa
cctgggcctcctggtgaagcgggattgcagggattacctggtatacccggaattcctggt
gcaaagggtgttgctggtgaaaagggtaacacaggtgctccagggaagcctggtcaattg
gggaattcaggcaaaccgggccaacaggggccgccaggagaggtgggacctcgaggacct
cgagggcttcctggcagtagaggagaaataggaccagtaggacccccaggaccgccaggt
aaactgggttctctcggcagccctgggctccctggcctgcctggccccccaggacttcct
ggaatgaaaggtgacaggggtgtagttggtgaacctggtccaaagggtgaacagggtgtc
tctggtgaagagggtgaagcaggagaaaggggtgaactcggagatataggattacctggc
ccaaaaggatccgtaggtaaccctggggagcctggcttgaggggacctgaaggaagccgg
gggcttcctggagtggaaggacctcgaggaccacctggcccgcgaggcgtgcagggagaa
cagggcgccactggcctgccggggattgaaggtcctccaggtagagcaccaactgatcag
cacattaagcaggtttgcatgagagtcatgcaagagcattttgctgcgatggctgctagc
ctcaagcgtccggaatcaggagcctctggcctccctgggcgtcctggtccccctggcccc
ccaggtccccctggagagaatggtttcccaggccagatgggacttcgtggccttccaggc
atgaaagggccccctggggctcttggtttgaggggacctaaaggtgacatgggagaaaga
ggtgatcgtggccctccaggaagaggtcccaaaggtttgcccggagctacaggtcttcca
ggtgacccgggacctgccagctacgggaggaatggccgggacggcgagcgaggaccccca
ggggtggcaggcattcctggtgtacccggccccccaggccctcctgggcctcctggtttc
tgcgaaccagcctcctgcaccatgcaggctgggcagcgggcatttaatagcaagggtcct
gaccagtga

DBGET integrated database retrieval system